KEGG   Paenibacillus polymyxa SC2: PPSC2_06060Help
Entry
PPSC2_06060       CDS       T01335                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
ppm00071  Fatty acid degradation
ppm00072  Synthesis and degradation of ketone bodies
ppm00280  Valine, leucine and isoleucine degradation
ppm00310  Lysine degradation
ppm00362  Benzoate degradation
ppm00380  Tryptophan metabolism
ppm00620  Pyruvate metabolism
ppm00630  Glyoxylate and dicarboxylate metabolism
ppm00640  Propanoate metabolism
ppm00650  Butanoate metabolism
ppm00900  Terpenoid backbone biosynthesis
ppm01100  Metabolic pathways
ppm01110  Biosynthesis of secondary metabolites
ppm01120  Microbial metabolism in diverse environments
ppm01130  Biosynthesis of antibiotics
ppm01200  Carbon metabolism
ppm01212  Fatty acid metabolism
ppm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PPSC2_06060 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    PPSC2_06060 (atoB)
   00640 Propanoate metabolism
    PPSC2_06060 (atoB)
   00650 Butanoate metabolism
    PPSC2_06060 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PPSC2_06060 (atoB)
   00072 Synthesis and degradation of ketone bodies
    PPSC2_06060 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PPSC2_06060 (atoB)
   00310 Lysine degradation
    PPSC2_06060 (atoB)
   00380 Tryptophan metabolism
    PPSC2_06060 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PPSC2_06060 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PPSC2_06060 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PPSC2_06060 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppm04147]
    PPSC2_06060 (atoB)
Enzymes [BR:ppm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PPSC2_06060 (atoB)
Exosome [BR:ppm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PPSC2_06060 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ADO55236
UniProt: E3EIC3
Position
complement(1398804..1399988)
Genome map
AA seq 394 aa AA seqDB search
MKKVAIVSPLRTAVGSFNKTLAPLSAPELGATVMTACLQQSKLEPSLIDQIFMGNVLQAG
NGQNPARQAALKAGIPIDVPESTINTVCGSGLHAVALAYDSILAEQGNIVLAGGMESMSN
APYLLKNARNGYKLGNGELVDSLVADGLTCPINHYHMGITAENVAEKYGISRLEQDSFAY
ESQIKAFEAKNNKFFEEQIVPVMIKNKKETTYFTEDEHIRGNTTKEKLSNLKPAFKEDGT
VTAGNASGINDGAAAMLVVSEDKCKEHALKPLAYIKGYSLVGVDPAYMGMGPVKAISSLL
KKQGMSIDDIDLFEINEAFAAQALAVQKELGVSPEKVNVNGGAIAIGHPVGASGARVLVT
LVHEMVRRSSRYGVVSLCIGTGMGIAMLVENALI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtagctatagtaagcccgttgagaacagcggtcggttcttttaacaaaacc
cttgcgcctctaagcgctcctgaattgggagcaaccgtgatgacagcatgcctgcagcaa
agtaaattggagccttctttgattgatcaaatttttatgggaaatgttcttcaagcgggc
aatggtcaaaatcctgccagacaggcggcactaaaagcgggtatccccattgatgtaccc
gaatcaacgataaacacggtttgcggttcaggacttcatgccgtcgcgttagcttacgat
tcaatattggcggagcaaggaaacatcgtcttggctggaggcatggagagcatgtcgaac
gccccttatctgctaaaaaatgcaagaaacggctataagcttggcaacggtgaattggta
gactccctggtggctgacggcctaacatgcccaatcaaccattaccatatgggaattact
gccgaaaatgttgccgaaaaatatggaatctcaagactggagcaagattcattcgcctat
gaaagccagataaaggctttcgaagcaaaaaacaacaagttttttgaagagcaaattgtt
ccggtcatgatcaaaaacaaaaaagaaactacttatttcacagaagacgaacacataaga
ggaaatacgacgaaagaaaaactttcaaacttgaagcctgcgtttaaagaggacggaacg
gttactgccggaaatgcttcgggaatcaatgatggtgcggcagctatgttagtcgtgtcg
gaagataaatgtaaggaacatgcgttaaagccgttggcatatatcaagggttattcgctt
gttggtgttgaccctgcatatatgggaatgggaccggtaaaagccatttcgtcactgctg
aagaaacagggaatgtcgattgatgacattgatctctttgaaattaatgaagcgttcgct
gcacaagcactagcggtgcaaaaagagctgggagtcagtccggaaaaggtcaatgtcaat
ggcggcgcgatcgcaatcggtcatcctgttggtgcaagcggtgctagggtattggttacg
ttagttcatgaaatggtgcgcagatcttcacgttacggcgtagtctcgttatgcatcgga
acgggaatgggaatagcaatgctggttgaaaatgcactcatttaa

DBGET integrated database retrieval system