KEGG   Paenibacillus polymyxa SC2: PPSC2_06280Help
Entry
PPSC2_06280       CDS       T01335                                 

Definition
(GenBank) formate--tetrahydrofolate ligase 1
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
ppm00670  One carbon pool by folate
ppm01100  Metabolic pathways
ppm01120  Microbial metabolism in diverse environments
ppm01200  Carbon metabolism
Module
ppm_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:ppm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    PPSC2_06280
Enzymes [BR:ppm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     PPSC2_06280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: ADO55286
UniProt: E3EIH3
Position
1450498..1451958
Genome map
AA seq 486 aa AA seqDB search
MKRIIDVAKEAGIEEEHLETYGKYKAKLNPSLWEQLKDRPNGKLVLVTAMNPTPAGEGKT
LTTIGLAQALNTMGHKTVAALREPSLGPCFGMKGGATGGGQAQIVPAEDINLHFTGDIHA
ISAAHNLLSAMIDNHLFHGNALRLKPDRIVWKRTVDMNDRSLRSIVTGLGTGNGAVRESG
FLITSASEVMAVLCLSENMDDLKVRLGRMVIGYNEAGEAVTAEELHAVEAMAVLLREALK
PNLVQTLEGTPVIVHGGPFANIAHGCSSLMGTKLALKLGEVVVTEAGFGAELGAEKFFDI
KCRQSGLQPDAAVLVVTAKALKYNGGVAKHELDAENLEQLQLGLANMSRHVRNLQKFGVP
VLVAINHFVTDSEAELDLIFSECRKLGVPAELSQVWAQGSQGGEKLAQSLLNLLQEDKAH
FAPLYDHTLDLQAKISVIAKELYGAAEVAYTPAAKRALAGMEQLGFDNCLYAWPKRRILS
QINLPC
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaagaggattattgatgttgccaaagaagcaggaattgaagaagagcatctggagacg
tatggcaaatataaagcgaagctgaatccatctctatgggagcagttaaaggatcgcccg
aatggaaagctggtgctggttacggcgatgaatcccactccggctggagaaggaaaaaca
ctgacaaccatcgggctggcacaggccctaaatacgatggggcataaaaccgttgctgca
ctgcgtgagccgtctcttgggccttgctttgggatgaaagggggagcaaccgggggagga
caggcccagattgttccggcggaagacattaatctgcattttacaggggatatccatgcc
atttcagctgcgcataatttgctgtcagcgatgattgataaccatttgttccatggaaat
gctttgcggctgaagccagaccgaattgtgtggaaacggactgtcgatatgaatgaccgg
agcttgcgaagtattgtgactggattgggaacggggaatggagcggtaagagaaagcggc
tttctgatcacctcggcctccgaagtcatggcggtactatgcttaagtgaaaatatggac
gatcttaaagtacgattgggtcggatggtaattggctataacgaagccggtgaggcggta
acagcagaggagctgcacgcggtggaagctatggctgtgctgcttcgggaagcattaaag
cctaatctggtgcagacattggagggcactccggttattgtgcatggtggaccttttgct
aatattgcccatggatgtagcagtctgatggggacaaagctggcgttgaagctgggagag
gtcgtcgtcacagaggcgggatttggggctgagctgggagcggaaaagttttttgacatc
aagtgccgccagtccggattgcagccggatgcggctgtgctggttgtaaccgccaaagcg
ctgaaatataacggcggtgtagctaaacatgagctggatgcggaaaatctggagcaattg
caactcggattagccaatatgagccgacatgtacggaatttgcaaaagtttggtgtgcct
gtactggtggcgattaaccattttgtaacagacagcgaagccgagttggatttgattttc
tcggaatgccgcaagctgggtgtacccgcagaactttcacaagtatgggcgcagggaagc
caagggggagaaaaattggcccaaagcctgctgaacttacttcaggaggacaaagcacat
tttgcaccgctatatgatcatacgcttgatttgcaagcgaaaattagtgtcattgccaag
gagctttacggtgcggcagaggtggcttacacgcctgcggccaaacgggcgttggcgggt
atggagcagcttggttttgacaactgcctgtatgcatggccaaaacgccgtattctttct
cagatcaaccttccttgctag

DBGET integrated database retrieval system