KEGG   Paenibacillus polymyxa SC2: PPSC2_06665Help
Entry
PPSC2_06665       CDS       T01335                                 

Gene name
cbiP
Definition
(GenBank) cobalamin biosynthesis protein CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
ppm00860  Porphyrin and chlorophyll metabolism
ppm01100  Metabolic pathways
Module
ppm_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:ppm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PPSC2_06665 (cbiP)
Enzymes [BR:ppm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     PPSC2_06665 (cbiP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA SNO
Motif
Other DBs
NCBI-ProteinID: ADO55364
UniProt: E3EDQ6
Position
1526337..1527956
Genome map
AA seq 539 aa AA seqDB search
MSTFEPSRTNPAAILMLQGTASDVGKSVVTTALCRIFLQDGYRPAPFKSQNMALNSYVTE
DGKEIGRAQGVQAEACGIEATTDMNPILIKPVKDMHSQIVVHGVPYAYMSASDYRKDFLP
QAKHTVMDALNRLRDTYDIVLMEGAGSPAEINLKDRDIVNMNLAGWADAPVLLVSDIDRG
GVFASLVGTIELLEPHEVQRIRGFIINKFRGDLSLLQPGLDWLEERTGIPVLGVLPYLPD
IRIEAEDSVVLDKKPKRSAKDKELDIAVIRYPRISNFTDTDALAVEPDVSVRYVTEAGQL
GVPDAIILPGTKDTIGDLLELRERGLEEDIREAMKTGRTQLVGICGGYQMLGTALFDPDA
VESGLPQQADGLGWLALSTTFLKEKQTVRVQGTLSNHCPLLLSAAPDSGSAVKPIIEGYE
IHMGVTEYVTEPHVSIDRTPDSTNMKTLFQIQRGEGAAFEEGWGTTDGKVWGTYLHGVFD
NDRFRRSWLDGLRQAKGLAALDSTFTVREAKEQEFDRVAEVVRAHLDMEQVYRILGMDS
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaactttcgaaccgtcccgcacgaacccggcagctatattgatgcttcaaggaaca
gcgtcggatgtgggcaaaagcgtagtaacgactgcgctgtgccggatctttctgcaggac
ggctatcgtcccgcaccgtttaagtcacaaaatatggcgttaaactcttatgttactgag
gacggcaaggaaattggacgtgctcagggtgtgcaggcagaagcctgtggtattgaggcg
acgaccgatatgaatccaattctgattaagccagtcaaggacatgcactcacaaattgtt
gtacacggtgtaccttatgcctatatgagcgcctctgattaccgaaaggattttttgcca
caagccaagcataccgttatggatgcgctgaatcggctgcgtgatacctatgatattgtg
cttatggaaggggcgggcagcccagcagagattaatttaaaggaccgcgatattgtaaat
atgaaccttgcaggctgggcggatgctccagtactgctggtttcggatatcgaccggggc
ggtgtctttgcctctctggtagggactatcgaattgctagaaccccatgaagtacagcgt
atccgtggatttatcattaacaaattcagaggcgatttgtccctgcttcaaccgggatta
gactggttggaagaacggacaggtattcctgtactcggtgtattgccctatttaccggac
attcgtattgaagcagaggactcggtcgtactggacaagaagcctaagcggtcagcaaaa
gataaagaattagatattgcggtgatacgatatccgcgtatttccaattttacggacacg
gatgctctggctgtagagcctgacgtgagcgtacgttatgtcacagaggccggacaattg
ggcgtaccggacgctattatcttaccgggaaccaaagacaccatcggagacctgctggaa
ttgcgtgaaagagggctggaggaagacattcgagaggctatgaagacgggacgcacgcaa
ctggttggtatttgtgggggctatcagatgctgggcacagcgctatttgaccccgatgcc
gtcgaatctgggttgccgcagcaggcagatggattaggatggctagctctatccacgacc
ttcttaaaggaaaagcaaaccgtgcgtgttcaaggaaccctgtctaatcattgcccgctt
ttgctaagcgctgcacctgattcaggttctgccgtcaagccaatcattgaaggttatgaa
atacatatgggtgttacggagtatgtcacggaaccacatgtatctatagacaggactcca
gactcaacgaatatgaaaacattattccagattcagcgtggggaaggggccgcctttgag
gaaggttggggcacgactgacggtaaggtatggggaacctacttgcatggtgtgtttgat
aatgaccgttttcgccggtcctggttggatggattacgacaagccaagggcttggcagct
ttagatagcacttttactgtacgtgaagccaaggaacaagagtttgaccgtgtcgcagag
gtggtacgcgctcatttagatatggagcaagtttatcgcattctggggatggattcataa

DBGET integrated database retrieval system