KEGG   Paenibacillus polymyxa SC2: PPSC2_14185Help
Entry
PPSC2_14185       CDS       T01335                                 

Gene name
bsaA3
Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
ppm00480  Glutathione metabolism
ppm00590  Arachidonic acid metabolism
ppm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    PPSC2_14185 (bsaA3)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PPSC2_14185 (bsaA3)
Enzymes [BR:ppm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PPSC2_14185 (bsaA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ADO56992
UniProt: E3E7V9
Position
complement(3213696..3214241)
Genome map
AA seq 181 aa AA seqDB search
MSIYDYSAIAMNGKEITLSDYKDKVVLIVNTASQCGFTFQYQDLQRLYDQYKDRGLVILG
FPCNQFADQEPDSNESVQTFCTLNYGVAFPMFQKVNVRDEQAHPLFTYLASSLPFEGFDE
THSVAKILIPLIHERHPEYLPGDSIKWNFTKFLIDRNGKVIKRFEATTDPLDMEEYIEAL
L
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttatgattattcagccattgcgatgaacggcaaggagatcacccttagtgat
tataaagataaagtagtgttgattgtaaatacggccagccagtgcggttttacatttcaa
tatcaggatttgcagcgtctatatgatcaatataaggatagaggcttggtgattctcggg
ttcccatgcaatcaatttgccgatcaagagccggattccaatgaaagtgtgcaaacattt
tgtactctgaattatggggtcgcattccccatgttccaaaaggtgaatgtacgtgatgag
caggctcacccgttgtttacatatcttgcttcgtcgttgccctttgagggctttgatgaa
acacattcggttgccaaaatacttattcctttaattcatgagcgtcatcctgagtactta
ccaggagattcgatcaaatggaatttcacgaaattcctgattgatcggaacgggaaagtg
atcaaacgatttgaagcaacgacagaccctctggatatggaagaatatattgaagcatta
ctgtga

DBGET integrated database retrieval system