KEGG   Paenibacillus polymyxa SC2: PPSC2_18175Help
Entry
PPSC2_18175       CDS       T01335                                 

Gene name
adhB1
Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
ppm00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ppm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PPSC2_18175 (adhB1)
Enzymes [BR:ppm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     PPSC2_18175 (adhB1)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     PPSC2_18175 (adhB1)
    1.1.1.-  
     PPSC2_18175 (adhB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N ADH_N_assoc Shikimate_DH 2-Hacid_dh_C Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ADO57842
UniProt: E3E9Q2
Position
4083813..4084865
Genome map
AA seq 350 aa AA seqDB search
MQALRWHGVKDLRLENIEQPAALPGKVKIKVEWCGICGSDLHEYVAGPIFIPENAQHPLT
GEKAPVVMGHEFSGQVVEIGEGVTKIQVGDRVVVEPVFACGECDACKQGKYNLCDKMGFL
GLAGGGGGFSEYVAADEHMVHKIPESVSFEQGALVEPSAVALYAVRQSQLKVGDKAVVFG
AGPIGLLVIEALKASGASEIYAVELSEERKAKAEELGAIVLDPKTYDVVEELHKRTNGGV
DVAYEVTGVPPVLTQAIESTKISGQIMIVSIFEKDAPIKPNNIVMKERNLTGIIGYRDVF
PAVISLMEKGYFPADKLVTKRIKLEEVIEQGFEGLLKEKNQVKILVSPQS
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcattgagatggcatggagtaaaagatttacgtttggaaaatattgagcagccc
gctgctcttcccggaaaagtaaaaatcaaagtcgaatggtgtggtatttgcggaagtgat
ctccacgaatatgtagcaggaccgatcttcattcctgaaaatgctcagcatccattgact
ggtgaaaaagctccggtcgtgatgggacatgaattttctggacaagtcgttgaaatcggt
gaaggcgtaaccaaaattcaggttggcgaccgtgtagtcgttgaacccgtttttgcatgt
ggagaatgtgatgcatgtaaacaaggcaaatataacctttgtgataaaatgggcttcctc
ggtttggcaggcggcggcggtggattttctgaatatgtggctgctgacgagcacatggtt
cacaaaattccagaaagcgtatctttcgagcaaggcgctttggtagagccttcggccgtt
gctttgtatgctgtacgtcaaagccagctgaaagtcggcgataaagctgtcgtatttggc
gctggtcctatcggattgctcgtgattgaagcgttgaaagcttcgggcgcatctgagatt
tatgcagtagagctttccgaagagcgtaaagccaaagctgaagagctgggtgctatcgtg
cttgatcctaagacttatgacgtagtggaagagctgcacaaacggaccaacggtggcgta
gatgtagcctatgaagtcactggagtacctcctgtgctgactcaagcgattgaatccact
aaaatcagcggacaaatcatgatcgtcagcatttttgaaaaagatgctccgatcaaaccg
aacaatatcgttatgaaggaacgcaatctgactggtattatcggctaccgtgatgtattc
ccggctgtcatcagcttgatggaaaaaggatatttccctgctgacaaacttgtgaccaaa
cgtattaagctcgaagaagtgatcgagcaaggttttgaaggtctcctgaaagagaaaaat
caggttaaaatcctggtatctccgcaatcctaa

DBGET integrated database retrieval system