KEGG   Paenibacillus polymyxa SC2: PPSC2_23010Help
Entry
PPSC2_23010       CDS       T01335                                 

Gene name
ddhB
Definition
(GenBank) CDP-glucose 4,6-dehydratase
  KO
K01709  CDP-glucose 4,6-dehydratase [EC:4.2.1.45]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
ppm00520  Amino sugar and nucleotide sugar metabolism
ppm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PPSC2_23010 (ddhB)
Enzymes [BR:ppm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.45  CDP-glucose 4,6-dehydratase
     PPSC2_23010 (ddhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 RmlD_sub_bind 3Beta_HSD NAD_binding_4
Motif
Other DBs
NCBI-ProteinID: ADO58843
UniProt: E3EBM5
Position
complement(5175199..5176269)
Genome map
AA seq 356 aa AA seqDB search
MLFWKGKKVLITGHTGFKGSWISIWLQKLGAEVMGFSMEPLTTPNLFSQAEVGSGMQTTY
GDIRDFNQLKQLICSFEPEIIFHMAAQSLVRKSYLDPLETFSTNIIGTANLFEAARSVDS
LRVIINVTSDKCYENKEWIWGYRENEPLGGSDPYSASKGCAELITTSYRSSFFSDGPSVA
SVRAGNVIGGGDWAEDRLVPDIIRSIVSNKIIFIRNPCSVRPWQHVLEPLYGYLLLAERM
WFDGKEYGDSWNIGPGDQEAVSVETLLRLFENAWGESLNIQYDDKGNHPHEANYLRLDCS
KAKLKLGWSSLLSVDTSIDWVVDWTRAYIQGEDMRRVTLNQISYFEEIIKEHSHHE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgctattttggaagggtaaaaaagttttgataaccgggcataccggttttaaagggagt
tggatctcgatctggttgcaaaaactgggggcagaagtaatggggttctcaatggaaccc
ctgactactcccaatctatttagtcaggctgaagtaggaagtggtatgcaaacaacatac
ggagatattcgggactttaaccaactgaagcaactcatatgttcgtttgaaccggaaatt
atctttcatatggcggctcagtctctagtgcgaaaatcgtatctcgatcctttggagaca
ttctcaaccaatattataggaactgccaatttgtttgaggctgctcgttcagtagacagt
ctccgagttatcattaacgttacgagcgataaatgctatgaaaataaagagtggatatgg
ggttatagggagaacgaaccactcggtggcagtgatccctatagtgcaagtaaaggttgt
gcggaattaattacaacctcgtatcgaagctccttttttagcgacggaccttcagtagct
agcgtacgtgctggtaacgtaatagggggaggagattgggcagaagaccgtttggtgcct
gatatcatccgctcaattgtaagtaataaaattatctttatccggaatccgtgttcagtt
agaccctggcaacatgttttagaaccgctgtacgggtacttactattagcagaaagaatg
tggtttgatggtaaagagtatggtgattcatggaacatcggtcctggggaccaagaagct
gtatcagtagaaacattgcttcggttgtttgaaaatgcatggggtgaatctttaaatatc
caatatgatgataaaggtaaccatccacacgaagccaattatctaagattggactgctca
aaagcaaagttgaagttgggatggtcttctctcttatctgttgatacaagcatagattgg
gtcgtggattggactcgagcttacattcaaggtgaggatatgcgtcgagtaacattaaat
caaatatcgtatttcgaagagatcataaaggagcatagccatcatgaatag

DBGET integrated database retrieval system