KEGG   Paludibacter propionicigenes: Palpr_1197Help
Entry
Palpr_1197        CDS       T01362                                 

Definition
(GenBank) Beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
ppn  Paludibacter propionicigenes
Pathway
ppn00511  Other glycan degradation
ppn00520  Amino sugar and nucleotide sugar metabolism
ppn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Palpr_1197
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Palpr_1197
Enzymes [BR:ppn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Palpr_1197
Chaperones and folding catalysts [BR:ppn03110]
 Intramolecular chaperones
  Others
   Palpr_1197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b F5_F8_type_C Fn3_assoc Glycohydro_20b2 CHB_HEX_C_1
Motif
Other DBs
NCBI-ProteinID: ADQ79344
UniProt: E4T3Q0
Position
complement(1448766..1451102)
Genome map
AA seq 778 aa AA seqDB search
MIKLSTFFRRRLMGVCVLVGCNSFSLLLAGEYNIIPYPQTLIPQSGSFTFNKRTTVYCPF
NKPEVLRLARQFSAHFEVVSGIKLAMADIANANRKTNNAVIFQPEVNLENAEAYRLSISA
NAISIKASAANGFFYGLHTLYQLLPEAIYGKKLVAGKKWSARAVEIKDSPRFAYRGLHLD
VCRHFFPIAFIKKYIDAMAIHKFNTFHWHLTEDQGWRIEIKKYPRLTEVGSKRAETLVGY
YYDRLPQAYDGKPYGGFYTQAEAREIVAYAKERFITVIPEIELPGHAQAAIAAYPYLSCK
QDSSVKVATKWGVFKEVYCPRDTTFKFLEDVLTEIMAIFPSTYIHIGGDECPKDRWKTCP
DCQAMIKNLNLKDENGLQSYFVHRIERFLNSKGRKMIGWDEILDGGLDPNATVMSWRGTQ
GGITAAKAGNDVIMTPGTYCYFDKYQAEPLNEPTTIGGFLPLKMVYEYEPIPTELTADEA
KHVLGAQANVWTEYMPTAESVEYMVFPRLSAMAEVVWSDKATRNWESFRNRMPSEFNRYE
QLGIKASKSFYEVQFQSAVTADKKLQISLSCDCPNARIHYIINGKTTVYKAPFILSESAE
VAAKAFIGGKQRGRTITKSYQLSKLTGLAYTQNQQGGWYDGGNSRALTDGVPGNDKVYAQ
WVGFGKGRDVELVVDMQSALKIEHFSVGMLNAPAMCAQISPEIKLYGSTDGVNYRLLAEK
HFTPPTSPDKVIVRPVFTFTPTEVRYLKVQLRNANYCPPDKLENAECGVLFLDEIGAW
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgataaaactttcaactttttttcgacgccgtttgatgggagtttgtgtgcttgtgggt
tgtaactcatttagtttgcttttggcaggcgaatacaacattattccttatcctcaaaca
ttaattccccaatccggttcatttacttttaataaacgaaccactgtttattgcccgttt
aataagccggaggtgttgaggctggcacggcagttttcagcgcactttgaggtggtttcg
ggcataaaattagccatggcggacattgctaacgctaatcggaaaaccaacaatgctgtg
atatttcagccggaggtgaatcttgaaaatgctgaagcttatcgcttgagtatttcggca
aatgcaatcagtataaaagcatcagcagctaacggtttcttctatggtttgcatactttg
tatcaacttttgcctgaagcaatctatggaaagaagttggtagcaggtaaaaaatggtcg
gcccgtgcggtggagattaaggactcgccacgttttgcttacagggggttgcatttggat
gtttgtcgtcatttctttccgatagcgtttatcaaaaagtatattgatgctatggccatt
cataaattcaatacttttcactggcatcttaccgaagatcagggttggcgcattgagata
aagaaatatccgcgtctgacggaagttggttcgaagcgtgctgaaacgctggtgggctat
tactacgaccggctacctcaggcgtacgatggtaaaccctacggtggattttatacgcaa
gccgaagcacgcgaaatagtggcttatgccaaagagcggtttattacggtgattcccgaa
atagaacttccggggcatgcacaggcggctattgcggcttatccgtatttgtcgtgcaag
caggattcgtcggtgaaagtggcaactaaatggggtgttttcaaggaggtatattgtccg
cgcgataccacattcaaatttctggaggatgtattgaccgagattatggctattttccca
agcacatatattcatattggtggtgatgaatgcccgaaagaccgttggaaaacctgtccg
gattgtcaggcaatgataaaaaatctgaatctgaaagatgaaaacgggctacagagctat
ttcgtacaccggatagagcggtttttaaattccaagggtcggaaaatgattggttgggat
gagatattggatggtggattggatcctaatgctacggtgatgtcctggcggggtacgcag
ggtggtataactgctgctaaagccggcaacgatgtgattatgactcccggaacatattgt
tatttcgataaataccaggccgaaccgctgaacgagccaaccactatcggcggcttttta
cccctgaaaatggtatacgaatatgaaccgatacctactgaacttactgccgacgaggca
aagcatgtgctgggtgcacaggccaatgtgtggacggagtatatgccgacggctgaaagt
gttgaatatatggtgtttcctcgtctttcggccatggcggaggtggtatggagcgataaa
gcaacccgaaattgggaatcgttcagaaaccgtatgccgtcggagtttaatcgttatgaa
cagttgggtatcaaagcttcgaagtctttctatgaggtccagtttcaatctgccgttaca
gccgataagaaattgcaaatctcgctttcgtgcgattgtcccaatgctcggattcattat
attattaatggcaaaaccaccgtatataaagctccgtttatcttgtcagaatcggctgaa
gttgcagctaaggcatttattggcggaaaacaacgggggagaacgattacaaaatcttat
cagttgagtaaattaaccggactggcttatacgcaaaaccaacaaggcggatggtacgac
ggcggaaattcacgagcattgaccgatggtgtgccgggcaacgacaaagtttatgctcag
tgggtaggttttggtaagggcagggatgttgagctggtggtggatatgcagtctgctcta
aaaattgagcatttcagtgtgggaatgttgaatgctccggctatgtgtgcgcaaatttcg
ccagaaataaaattgtacggttcgacggatggtgtgaactaccgtctgctggctgagaaa
cattttactccacctacatctcccgataaagttatcgtacgtcccgtgtttacattcacg
cctaccgaggtgcgttacctgaaggttcaactccgaaatgctaattattgtccacccgat
aaattggaaaatgctgaatgtggcgtcttgtttttggatgaaataggggcatggtaa

DBGET integrated database retrieval system