KEGG   Paludibacter propionicigenes: Palpr_1924Help
Entry
Palpr_1924        CDS       T01362                                 

Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
ppn  Paludibacter propionicigenes
Pathway
ppn00790  Folate biosynthesis
ppn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Palpr_1924
Enzymes [BR:ppn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Palpr_1924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind IMS
Motif
Other DBs
NCBI-ProteinID: ADQ80063
UniProt: E4T5R9
Position
complement(2333106..2333954)
Genome map
AA seq 282 aa AA seqDB search
MSNFPLQINLNQQLVDLSVPVVMGIVNVTPDSFYKGSRFASDRSVLHAVESMVIDGAKII
DVGGYSTRPQAELISQEEEIRRLSEGLEAILKRFPDILISVDTFRSGVARHVVNNYRVAM
INDVGGGTLDDLMFETIADLQVAYVLMHMRGNPQSMQSLTLYDDIASEVLHFLERKLAQL
RLLGVKDVVVDPGFGFAKDLDQNYTLLSKLAYFKQLNVPVLAGLSRKSMLSKLLGIDASE
ALNATTAANMLALIGGASILRVHDVKEAVQAVEIYKKYIETK
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatttccctttgcaaattaatttaaaccaacagttggttgacttatcagtgccc
gttgttatgggaattgtcaatgtgactccggactctttttacaagggaagcaggtttgct
agcgatcgatcggttttgcatgccgtggagagtatggtgattgatggagcaaaaatcatt
gatgtgggtggttattctacccgaccccaagccgaacttatttcgcaggaagaagaaata
agacgtttatcggaaggactggaggcgattcttaaaagatttccggatattcttatttct
gtggatactttcaggtcgggagttgcaagacacgtggtgaataactaccgggttgcgatg
atcaatgatgtaggcggtggtacgttggacgatttgatgtttgaaacaattgcagatttg
caggtagcttacgtactaatgcatatgcgcggaaatccgcaatcaatgcaatcgctgacg
ctgtatgatgacattgcgtctgaagttcttcattttctggaaaggaaacttgctcaattg
cgcttgctgggagtgaaagatgtggttgtagatcccggatttggctttgccaaagatctt
gatcaaaattacacgttacttagcaaactggcttattttaagcagttgaatgttcctgta
cttgcaggtttatcgcgcaaatctatgctgagcaaattacttgggatagatgcttcggaa
gcgttaaatgccacaacggcagctaatatgcttgcattgattggtggagcgtccatactt
agggtacatgatgtgaaagaagccgtccaagcagtagaaatatataaaaagtacattgaa
acaaaatag

DBGET integrated database retrieval system