KEGG   Paludibacter propionicigenes: Palpr_2011Help
Entry
Palpr_2011        CDS       T01362                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ppn  Paludibacter propionicigenes
Pathway
ppn00010  Glycolysis / Gluconeogenesis
ppn00620  Pyruvate metabolism
ppn00640  Propanoate metabolism
ppn00680  Methane metabolism
ppn01100  Metabolic pathways
ppn01110  Biosynthesis of secondary metabolites
ppn01120  Microbial metabolism in diverse environments
ppn01130  Biosynthesis of antibiotics
ppn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Palpr_2011
   00620 Pyruvate metabolism
    Palpr_2011
   00640 Propanoate metabolism
    Palpr_2011
  Energy metabolism
   00680 Methane metabolism
    Palpr_2011
Enzymes [BR:ppn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Palpr_2011
Lipid biosynthesis proteins [BR:ppn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Palpr_2011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADQ80148
UniProt: E4T604
Position
complement(2445519..2447174)
Genome map
AA seq 551 aa AA seqDB search
MLEKFLQQTEFKDFEDFKANYKLIVPENFNFAYDIVDAWAAKEPDKRALLWTNDQGECRE
FTFGEMKKYTDQTASYFQSLGIKKGDIVMAILKRRYEFWFTIVALHKIGAIIIPATHLLT
KKDLVYRNNAADIKAIIAVGEEPIITHINDAMPESPSVEMLISVGHIIPEGWLDFHEGID
NAEPFTPIKNVNKNDDPLIISFTSGTTGNAKMVLLDCVYPLAHIITAKYWHNLREDSLHL
TIADTGWLKAVWGKLYGQWIVGACVFVYDHEKFTPSAMLEMIQKYKITSLCAPPTIFRFL
IREDLTHYDLSSLEYCTIAGEALNPAVYEQFLKLTGIKLKEGYGQSETTLSLFTAPWVEP
KPGSMGLINPHYDVDLLTPEGRSAEVGEQGQIVIRTDKRYPEGLFKGYYRNAELTNEAWH
HNVYYTGDVAWRDEDGYFWFVGRADDVIKSSGYRIGPFEVESALMTHPAVVECAITGVPD
EIRGQVVKATIILSNEYKDKAGEALVKEIQEHVKNVTAPYKYPRIIEFVDALPKTISGKI
RRTEIREKDNK
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaaaatttcttcaacaaaccgaattcaaagactttgaagatttcaaagcaaat
tacaaactaatagttcccgaaaatttcaattttgcctacgatatagtcgatgcctgggca
gctaaagagcccgataaacgcgcattgctttggaccaacgatcagggagaatgccgcgaa
tttacatttggcgaaatgaaaaaatacaccgaccaaacggcttcgtattttcaaagtctg
ggaataaaaaaaggtgatattgtaatggctatccttaaacgccgttacgaattctggttt
accattgtggctttgcataaaattggtgccatcattatccccgccacacacctgctcacc
aaaaaggatttggtttaccgcaacaatgcagccgatattaaagctattatagccgttggc
gaagaacctatcatcacacacatcaacgatgcaatgcctgaatcgcccagtgtggaaatg
ttgatctcggttgggcatattattcctgaaggttggctcgatttccacgagggaattgat
aatgccgaaccttttactccaatcaaaaacgtaaataaaaacgacgatccgcttattatc
agttttacatcaggaactaccggcaatgccaaaatggttttgctggattgcgtatatccg
ttggcacatattatcactgccaaatattggcataatttacgtgaagacagccttcacctt
accattgccgataccggctggcttaaagccgtttggggtaagctttacggacagtggata
gtgggtgcatgtgtatttgtatacgatcatgagaaatttaccccgtcagctatgttagag
atgattcagaaatataaaatcacttcgctttgtgcacctccaactattttccgcttcctc
attcgcgaagatcttacccactatgatctatcatccctggagtattgcactattgccggt
gaagcgttgaatccggctgtttacgaacaatttcttaaacttaccggcattaagcttaaa
gaaggttacggacaaagcgaaaccacactatcgctgtttaccgcaccttgggtagaacca
aaaccgggttctatgggattaattaacccacattacgatgtagacttacttactcccgaa
ggtcgttcggccgaagtgggtgaacaagggcagattgtgatacgtactgacaagcgctat
cctgaaggacttttcaaaggatattaccgcaacgctgagcttaccaacgaagcatggcac
cacaatgtgtattacaccggtgatgtagcatggcgcgacgaagatggatatttctggttc
gtagggcgtgctgacgatgttatcaaaagttccggataccgcataggaccattcgaggtt
gaaagcgccctgatgacacacccggcagtagttgaatgtgccatcactggtgttcctgac
gagatacgtggacaagtggtgaaagctaccattattttatcgaatgaatacaaggataaa
gccggcgaagcgttggtaaaagaaattcaggagcatgtaaaaaatgtaactgcgccctat
aagtacccacgtattattgagtttgtcgatgctctgccaaagacaatcagtggtaagatc
cgcagaacagaaattcgagaaaaagacaataaataa

DBGET integrated database retrieval system