KEGG   Paludibacter propionicigenes: Palpr_2078Help
Entry
Palpr_2078        CDS       T01362                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K00091  dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
ppn  Paludibacter propionicigenes
Brite
Enzymes [BR:ppn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydroflavonol 4-reductase
     Palpr_2078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_4 NAD_binding_10 GDP_Man_Dehyd RmlD_sub_bind Polysacc_synt_2 NmrA KR adh_short
Motif
Other DBs
NCBI-ProteinID: ADQ80215
UniProt: E4T671
Position
complement(2523133..2524110)
Genome map
AA seq 325 aa AA seqDB search
MKVLVTGANGLLGHHVVFELVKRQLDVRVIVRSTENIYFDVAKTDVYVGNFTDYESLKQA
AAGCDAIIHIAAVTATDLLHYEDYSKINVDGSRLLLKVANELNINKIVYVSSANTIGFGT
EQEPADECFNIEFPFTESYYAQSKVASEKLFIEASKKSNMHVVIINPTFMIGSYDTKPSS
GKLMLMGYKKRLMLIPKGGKNFVSAHDVAVSVCNALVEGQTGERYLASGINLSFKEFYSL
QIQIENYKQYIIELPDFILILAGKAGDLLRKAGIATEVCSMNLRQLMIKEYYRNSKAKAE
LHLPETDLKIAIKEAIDWFKNHNMT
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttttagttactggtgctaacggattattgggtcatcatgttgtatttgaatta
gtaaaacgtcaacttgatgtaagagttattgtcagaagtacagaaaatatttactttgat
gtggctaaaacagacgtatatgttggtaattttactgattatgaaagcctgaaacaagct
gctgcaggatgtgatgctatcatacacattgctgctgtaacggctactgatttgttgcat
tacgaggactacagcaagattaatgtggatggttcaagactgcttttaaaagtagccaat
gaattgaatattaataaaattgtttacgttagctctgccaataccattggattcggaact
gaacaagaacctgcggacgaatgttttaatattgaatttccatttacagaatcgtactat
gcgcaaagtaaagtagcttctgaaaaattgtttatagaagcttctaaaaagtccaatatg
cacgtggttattatcaacccgacgtttatgattgggtcgtacgataccaaacccagctca
ggcaaactgatgttgatgggttataaaaaaaggttgatgctaattcccaaaggtggtaaa
aattttgtttctgcacacgatgtagccgtttcggtttgtaatgcattggttgaaggccag
accggtgagcgttatttggcttctggaattaatctttcatttaaagaattctattcactt
caaatccaaattgaaaattataagcaatatattattgaattaccggattttatactaatt
ttggcaggtaaagcaggtgatttattacggaaagcgggaattgccactgaggtttgcagc
atgaatctgaggcaattgatgataaaagaatattaccggaatagtaaagcaaaagccgaa
ttacatttaccggaaacagatttaaaaatagccataaaagaagcaatagactggtttaaa
aatcacaatatgacgtaa

DBGET integrated database retrieval system