KEGG   Paludibacter propionicigenes: Palpr_2385Help
Entry
Palpr_2385        CDS       T01362                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
ppn  Paludibacter propionicigenes
Pathway
ppn00790  Folate biosynthesis
ppn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Palpr_2385
Enzymes [BR:ppn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Palpr_2385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF DUF3638
Motif
Other DBs
NCBI-ProteinID: ADQ80517
UniProt: E4T723
Position
complement(2890858..2891454)
Genome map
AA seq 198 aa AA seqDB search
MDFNLNQPVPFDAEKTAKIAEHYHQIIELLGEDVNREGLLKTPERVSKAMQFLMQGYEQD
PEEILRSAMFTENYRQMVIVKDIDFYSMCEHHMLPFFGKAHIAYIPNKQITGLSKIARIV
EVYARRMQVQERMTTQIKACIQKTLNPMGVMVIIEAQHLCMQMRGVQKQHSITTTSDFTG
VFEQAKTREEFMNLINRK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggatttcaatctcaaccaaccggttccttttgacgcagagaaaacagctaaaattgcc
gaacattaccaccaaattatagaattactgggcgaagacgtaaatcgtgaaggtttactg
aaaacccccgaacgtgtttcgaaagccatgcagtttttgatgcagggctacgagcaggat
ccggaagaaatactccgctcggccatgtttaccgagaactaccgccaaatggtaatcgtg
aaggacatcgatttctactccatgtgtgagcatcacatgctaccgtttttcggcaaagcg
catatcgcctatattccgaacaaacaaattaccggattgagcaaaatagcccgtatagtg
gaggtatatgcccgccgcatgcaggtacaggaacgcatgaccacgcaaataaaagcctgt
attcagaaaacattgaaccccatgggcgtgatggtaattatcgaagcgcaacacctttgc
atgcaaatgcgcggagtgcagaaacaacattctatcaccaccacttcggactttactggt
gtatttgagcaggctaaaacccgcgaagaattcatgaatctgatcaacaggaaatga

DBGET integrated database retrieval system