KEGG   Paludibacter propionicigenes: Palpr_2797Help
Entry
Palpr_2797        CDS       T01362                                 

Definition
(GenBank) hydroxymethylbutenyl pyrophosphate reductase
  KO
K03527  4-hydroxy-3-methylbut-2-en-1-yl diphosphate reductase [EC:1.17.7.4]
Organism
ppn  Paludibacter propionicigenes
Pathway
ppn00900  Terpenoid backbone biosynthesis
ppn01100  Metabolic pathways
ppn01110  Biosynthesis of secondary metabolites
ppn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Palpr_2797
Enzymes [BR:ppn01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.7  With an iron-sulfur protein as acceptor
    1.17.7.4  4-hydroxy-3-methylbut-2-en-1-yl diphosphate reductase
     Palpr_2797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LYTB Hex_IIIa
Motif
Other DBs
NCBI-ProteinID: ADQ80926
UniProt: E4T882
Position
3349633..3350514
Genome map
AA seq 293 aa AA seqDB search
MLNIEIDKKSGFCFGVVKAITKAEEELAKGETLYCLGDIVHNGQEVERLTKMGLITIDHE
QFALLHDAKVLLRAHGEPPKTYDIAKENNLTLIDASCPVVLKLQNRIKKAYQNAPSPDTQ
IVIYGEKGHAEVNGLVGQTDEKAIVIESEADLDKLDFNKKIQLFSQTTKSLEGFNELVIT
LSKKVQNNDNFEFFDTICRQVANRIPNITTFASQNDIVIFVSGKKSSNGKVLYQHSKKIN
PNTYLVTEANEVTGLDLDLTKQIGICGATSTPRWLMEEVADKLKEMSLSLERI
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgttgaatatagaaattgataaaaaatcagggttttgtttcggagttgtaaaagctata
acaaaagctgaagaagaattagcaaaaggtgagacattatattgtttgggtgatatagtt
cataacggacaagaagtagaacgactcaccaagatggggctgataacgatagatcatgag
cagtttgccttactgcatgatgctaaagtgttgctcagagcgcacggtgaaccacccaaa
acttatgatatagcaaaggaaaacaatctgacgctaattgacgcatcgtgtcctgtggtt
ttgaaacttcaaaatcgtattaagaaagcttatcagaatgctccgtcgcccgatactcaa
atagtgatatacggcgaaaaaggccatgccgaagtgaatggccttgttggtcagacagat
gaaaaggccattgtgattgagagtgaagcagatttggataaattagactttaataaaaaa
attcagcttttttcacaaaccactaagtctctcgaaggttttaatgaattagtaataact
ttatcaaaaaaagttcaaaataatgacaattttgaatttttcgatacaatttgccgacaa
gttgcaaacagaattccaaatattactacctttgcaagtcaaaatgatatagtcattttc
gtaagcggaaaaaagagctcaaacggaaaggttttgtatcagcacagtaagaaaattaat
cctaatacttaccttgttaccgaagcaaatgaagtaaccgggctggatcttgatctgaca
aaacagattggaatatgtggagctacgtcaacaccccgttggttgatggaggaagtagcc
gataaattaaaggaaatgtcgttgagtttggaacgaatatag

DBGET integrated database retrieval system