KEGG   Paludibacter propionicigenes: Palpr_2890Help
Entry
Palpr_2890        CDS       T01362                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ppn  Paludibacter propionicigenes
Pathway
ppn00260  Glycine, serine and threonine metabolism
ppn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ppn01100  Metabolic pathways
ppn01110  Biosynthesis of secondary metabolites
ppn01130  Biosynthesis of antibiotics
ppn01230  Biosynthesis of amino acids
Module
ppn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Palpr_2890
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Palpr_2890
Enzymes [BR:ppn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Palpr_2890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADQ81019
UniProt: E4T8H5
Position
3448528..3449928
Genome map
AA seq 466 aa AA seqDB search
MALTNQLIVRGNTCVYCQNKKILQKGLSELTISLFFILPLVPEGELNYNCLFKTTSMNKE
KDMQNETNSNSPLGAGGIDENGYYGEFGGAYIPEILHGSFERLKEAFYAIKDDAGFKAEY
YELLKNYVGRPSPLYFASRLSAEYGTKVYLKREDLNHTGAHKINNALGQILLAKRMGKTR
IIAETGAGQHGVATATACALMGLECIVFMGKTDVERQFLNVQKMRMLGATVEPVTSGNMT
LKDATNEAFRYWCSNPDSFYIVGSTVGAHPYPDMVGFFQSVISEEIKWQLQEQIGRDYPD
YLMACVGGGSNAMGTYYHYLNDDRVKIVSAEAGGLGVDTGETAATISLGTTGIIHGAKTL
LIQDEDGQIIEPYSISAGLDYPGIGPAHAFFAKSGRTKVLAINDDEALDAAFELTRLEGI
IPAIESAHALALLKKEKATFKPDDIVVLTVSGRGDKDMDTYVKHFK
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
gtggcacttacgaatcagctaatcgtgagaggtaacacctgtgtatattgtcaaaacaaa
aagatattacaaaaaggcttgtcggaactcacgataagccttttttttattttaccccta
gtccctgaaggggaactaaattacaactgtttatttaaaacaactagtatgaataaagag
aaagatatgcaaaacgaaactaattccaactcccctttaggagctggaggcattgacgaa
aacggatactacggtgaatttggcggagcatatatccccgaaattttgcatggttctttt
gaacgactgaaggaagccttctatgctataaaagatgatgccggatttaaagcagaatat
tacgaattgttgaaaaactacgtgggacgcccctcgccattgtattttgccagtagactg
tcggcggaatatggaacaaaagtttacctgaagcgtgaagacctgaatcacacaggagca
cataaaataaacaatgcgttgggacaaattctgcttgccaaacggatggggaaaacccgt
attattgcagaaacaggtgccgggcagcacggtgtggccacagcgactgcttgtgcgttg
atggggttggaatgtattgtatttatgggtaaaaccgatgtggaacgccagtttctgaat
gtgcagaagatgcgcatgttgggcgccactgtcgaaccggttacaagtggcaatatgacg
ctgaaagatgctaccaacgaagcttttcgctattggtgctccaatcctgattctttttat
attgtaggttccacggtgggtgcgcacccttatccggatatggtgggtttcttccaatca
gtgatcagcgaggaaattaaatggcaactgcaggaacaaattgggcgtgattatcctgat
tacctgatggcctgcgtaggcggaggtagcaacgctatgggaacttattatcattatctg
aatgatgaccgcgtgaaaattgtatcagcagaagcaggaggtttaggtgttgataccggc
gaaacggctgcaaccatttcgttgggaacaacaggtattatccatggagccaaaacattg
ttgattcaggatgaagatggacaaattatagaaccctattccatttcagcaggattggat
tatccgggaatcggtcctgcacatgcgttttttgcaaagtcgggccgaacaaaagtgttg
gcaataaatgacgacgaagcactggatgctgctttcgaactcacccgactggaaggaatt
attccggctatagaatcggcgcacgcgctggcactcttgaaaaaagaaaaagcaactttt
aaacccgatgatattgtggttctcacagtttctggtcgtggtgacaaggatatggatact
tatgtgaagcattttaaataa

DBGET integrated database retrieval system