KEGG   Paludibacter propionicigenes: Palpr_3030Help
Entry
Palpr_3030        CDS       T01362                                 

Definition
(GenBank) phosphate butyryltransferase
  KO
K00634  phosphate butyryltransferase [EC:2.3.1.19]
Organism
ppn  Paludibacter propionicigenes
Pathway
ppn00650  Butanoate metabolism
ppn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Palpr_3030
Enzymes [BR:ppn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.19  phosphate butyryltransferase
     Palpr_3030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB
Motif
Other DBs
NCBI-ProteinID: ADQ81158
UniProt: E4T8P9
Position
complement(3650317..3651228)
Genome map
AA seq 303 aa AA seqDB search
MELITSFAELTSHLKNINQRKRLAVANAVDSHTLDAVLKAVDMGIVEAFLIGDVASIESP
HLFEEHNLSPFIHIIDIPEVQLATLEAVRMVKAGEADILMKGLVNTDVLLRAILDKEKGI
LPAGNVLTFNAALQIPNYHKLIFFSDPVVIPSPNLVQRIAMIKYAIKTAYKFGISKPKVA
LIHATEVANPKIHYMQDYLDIMQMWREGEFGNVIMDGPLDIFLALDKERGSIKNVPSPVL
GDADILIFPNFECANCFYKGLSLFAGAEMGGLLQGTEKPVVLTSRSESVQSKFYSIAMAC
VIS
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggaactaataacatcgtttgccgaactcacctcacatcttaaaaacataaaccagcgt
aaacgtctggcggttgccaatgctgttgattcgcacaccttggatgctgttctaaaagca
gtggacatgggcattgttgaagcttttttgattggcgatgtcgcttccattgaatcacct
catctttttgaagaacataacttatctccttttattcatatcatagacattcctgaagtt
caattagctacgttggaagcagttcgcatggtaaaagccggagaagcagacattttaatg
aaagggttagtgaatactgatgtattgctccgggctattttggacaaggaaaaaggaata
ttgccagccggcaatgttctcacgttcaatgctgctctacagattcctaactatcacaaa
ttgattttcttctctgatccggttgtgattccatcaccaaatctggttcaacgcattgcc
atgataaaatatgctatcaagacagcctacaaatttgggatatcaaaacctaaagtggca
cttatccatgcaaccgaagtagcaaatcctaagattcattatatgcaggattatcttgac
atcatgcagatgtggcgtgaaggtgaatttggaaatgtcatcatggatggaccgctggat
atttttctggcgttagacaaagagcgtggaagcataaaaaatgtaccatctcccgtttta
ggcgatgccgacatcctcattttccccaattttgaatgcgcaaactgtttttataaaggc
ctatcgctctttgcaggagccgaaatgggtggattactacaaggcactgagaaacctgtg
gtattgacctcgcgtagcgaaagcgtacaatcgaagttctacagcatcgctatggcttgt
gtgataagttga

DBGET integrated database retrieval system