KEGG   Pandoraea pnomenusa DSM 16536: LV28_03855Help
Entry
LV28_03855        CDS       T03411                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppnm  Pandoraea pnomenusa DSM 16536
Pathway
ppnm00071  Fatty acid degradation
ppnm00072  Synthesis and degradation of ketone bodies
ppnm00280  Valine, leucine and isoleucine degradation
ppnm00310  Lysine degradation
ppnm00362  Benzoate degradation
ppnm00380  Tryptophan metabolism
ppnm00620  Pyruvate metabolism
ppnm00630  Glyoxylate and dicarboxylate metabolism
ppnm00640  Propanoate metabolism
ppnm00650  Butanoate metabolism
ppnm00900  Terpenoid backbone biosynthesis
ppnm01100  Metabolic pathways
ppnm01110  Biosynthesis of secondary metabolites
ppnm01120  Microbial metabolism in diverse environments
ppnm01130  Biosynthesis of antibiotics
ppnm01200  Carbon metabolism
ppnm01212  Fatty acid metabolism
ppnm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppnm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LV28_03855
   00630 Glyoxylate and dicarboxylate metabolism
    LV28_03855
   00640 Propanoate metabolism
    LV28_03855
   00650 Butanoate metabolism
    LV28_03855
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LV28_03855
   00072 Synthesis and degradation of ketone bodies
    LV28_03855
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LV28_03855
   00310 Lysine degradation
    LV28_03855
   00380 Tryptophan metabolism
    LV28_03855
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LV28_03855
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LV28_03855
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LV28_03855
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppnm04147]
    LV28_03855
Enzymes [BR:ppnm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LV28_03855
Exosome [BR:ppnm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LV28_03855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Alk_phosphatase
Motif
Other DBs
NCBI-ProteinID: AIU25790
UniProt: V5UL84
Position
2305683..2306864
Genome map
AA seq 393 aa AA seqDB search
MQREVVIVSGVRTAIGDFGGSLKDFAPTQLGAIVAREAMARAQVSGEDVGHVVFGNVIHT
EPKDMYLARVASIEAGVSQHAPAMTVNRLCGSGLQAVVSAAQSILLGDAEVAMAGGAESM
SRAPYVMPGARWGTRMGESRLVDMMLGALHDPFANIHMGVTAENIAKQWGITREDQDRLA
VESHQRAARAMAEGYFRDQIVPISIKTKKGEIAFTTDEHVRADVRLEDMAKLRPVFEKDG
TVTAGNASGLNDAAAALILMERAEAQRRGAKPLARLVSYAHAGVDPNYMGIGPVPASRKA
LERAGLQVGDIDVVEANEAFAAQACAVTRDLGFDPARVNPNGSGISLGHPIGATGALITV
KALHELQRIGGRYALVTMCIGGGQGIAAVFERV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgagaagtcgtgatcgtcagcggagttcgtaccgcgatcggtgattttggtggc
agcctgaaggatttcgcgccgacgcagctcggtgcgatcgtcgcccgcgaagccatggcg
cgcgcgcaagtcagcggcgaagacgtcggacacgtggtgttcggcaacgtcattcatacc
gaacccaaggacatgtatctggcgcgcgtcgcctcgatcgaggctggcgtgagccagcac
gcgccggccatgacggtgaaccgcctgtgcggctcggggctacaggccgtggtctcggcc
gcgcagtcgatcctgctcggcgacgcggaagtggcaatggcgggtggcgcggagagcatg
agccgtgccccgtacgtgatgccgggcgcgcgctggggtacccgaatgggcgaatcgcgc
ctggtcgacatgatgctcggcgcgctgcacgatccgttcgccaacatccacatgggcgtg
acggcggagaacatcgcgaagcagtggggcatcacgcgcgaggatcaggatcgtctcgcc
gtcgagtcgcaccagcgcgccgcgcgcgcgatggccgaggggtacttcagggatcagatc
gttcccatctcgatcaagacgaagaagggcgagatcgcgttcacgaccgacgagcacgtg
cgggccgacgtacgtctggaagacatggcgaagttgcgtcccgtgttcgagaaggacggc
accgtgacggcggggaatgcgtcgggcctgaacgatgccgcggccgcgctgatcctgatg
gagcgcgccgaagcgcagcgccgcggcgcgaagccgctggcgcgtctggtgagctatgcg
cacgcaggcgtggaccccaattacatgggcatcggtcccgtgccggcctcgcgcaaggcg
ctcgagcgtgccggactccaggtcggcgacatcgacgtggtggaggcgaacgaagccttt
gccgcccaggcctgcgcggtcacgcgcgatctcggcttcgatccggccagggtcaatccg
aacggctcgggcatttcgcttggccatccgatcggcgcgacgggggcactgattaccgtc
aaggcgctgcatgaactgcagcgcatcggtggccggtacgcgctggtgacgatgtgcatc
ggcggcggccagggcattgcggccgtgttcgagcgcgtgtaa

DBGET integrated database retrieval system