KEGG   Pandoraea pnomenusa DSM 16536: LV28_05380Help
Entry
LV28_05380        CDS       T03411                                 

Definition
(GenBank) acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
ppnm  Pandoraea pnomenusa DSM 16536
Pathway
ppnm00020  Citrate cycle (TCA cycle)
ppnm00620  Pyruvate metabolism
ppnm00650  Butanoate metabolism
ppnm01100  Metabolic pathways
ppnm01110  Biosynthesis of secondary metabolites
ppnm01120  Microbial metabolism in diverse environments
ppnm01130  Biosynthesis of antibiotics
ppnm01200  Carbon metabolism
Module
ppnm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppnm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppnm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LV28_05380
   00620 Pyruvate metabolism
    LV28_05380
   00650 Butanoate metabolism
    LV28_05380
Enzymes [BR:ppnm01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     LV28_05380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans LUD_dom
Motif
Other DBs
NCBI-ProteinID: AIU26051
UniProt: A0A378YHF5
Position
complement(1974571..1976067)
Genome map
AA seq 498 aa AA seqDB search
MFEDRIRLASLRDRVMSADDAAKLIGDGMVVGMSGFTRAGDAKDMPIALAKRAKAHPMKI
TLITGASLGHDSDKTLTQAGVLAKRLPFQVDTTLRGAINRGEVMFVDQHLSETVEFLRAG
QFGRLDVAVIEAVAITEDGGLVPSSSVGNSASFAILADKVIVEINLAQPLAFEGMHDIWI
PAQRPHRTPLPIVDVRDRVGTNVVKIAPEKIAAIVITDTPDSASNALPPDAETQMIAGHL
IEFFQHEVSRGRLPRTLPAIQSGIGTIANAVLSGFLESPFEDLTMYSEVLQDSTFELMDA
GKMVFASGSSITVSQAVQDRVFKHLERYRDKLVLRPQEVSNHPEVIRRLGLIALNTALEA
DIYGNVNSTHVGGTHMMNGIGGSGDFARNARVAIFATKSIAKDGRISSIVPMVPHVDHNE
HDVDIIVTEQGLADLRTLAPRERVNLVIDHCAHPSYRDVLRDYYRDALRYGGQTPHALER
AFDMHINLRERGSMLAGK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaagatcgcatccgcctggcgtcgctgcgcgaccgggtgatgagcgccgacgat
gccgcgaagctgatcggcgacggcatggtggtcggcatgagcggattcacccgcgccggc
gacgccaaggacatgccgattgcgctggcaaagcgggcaaaggcccacccaatgaagatc
acgttgatcaccggggcatcgctcgggcacgactccgacaagacgctcacgcaggccggc
gtgcttgccaagcgcctgccgttccaggtcgacacgacgttgcgcggcgcgatcaatcgc
ggcgaggtcatgttcgtcgaccagcatttgtccgagaccgtcgagttcttgcgcgccggc
cagttcggccggctcgacgtggccgtgatcgaagccgtggccatcacggaagacggcgga
ctcgtgccgagctcgtcagtcggcaattcggcgagcttcgcgattctcgcggacaaggtc
atcgtggagatcaacctcgcgcagccgctcgcgttcgagggcatgcacgacatctggatt
ccggcccagcgcccgcaccgcacgccgctgcccatcgtcgacgtgcgcgaccgcgtgggc
acgaacgtggtgaagatcgctcccgaaaagatcgcggccatcgtcatcaccgatacgccc
gacagcgcttcgaatgcgctgccgcccgacgccgaaacgcaaatgatcgccggccatttg
atcgagttcttccagcatgaagtctcgcgtggacgcctgccgcgcacgctgcccgccatt
caatcgggcatcggcacgatcgcgaacgcggtgctctcgggcttcctcgaatcgccgttc
gaggatctcacgatgtattccgaggtactccaggactcgaccttcgagctcatggatgcg
ggcaagatggtattcgcttcggggtcgtcgatcacggtgtcgcaagccgttcaggaccgc
gtattcaagcacctcgagcgctatcgcgacaaactcgtgctgcggccgcaggaagtcagc
aaccaccccgaagtcattcgccgtctaggtctgatcgcgctgaacaccgcgctcgaagcg
gatatttacggcaacgtgaattccactcacgtgggcggcacgcacatgatgaacggcatc
ggtggctcgggcgacttcgcccgcaacgcccgcgtggcgattttcgccaccaagtcgatc
gccaaggacggcaggatatcgagcatcgttcccatggtgccgcacgtcgaccacaacgag
catgacgtcgacatcatcgtgaccgaacagggtctggccgacctgcgcacgctcgccccg
cgcgagcgcgtgaatctggtgatcgaccattgcgcccacccgagctaccgcgacgtgctg
cgcgactactaccgcgatgcactgcgatatggcggacagacgccgcacgcgctcgagcgc
gctttcgacatgcacatcaacctgcgcgagcgcggctcgatgctcgcggggaagtga

DBGET integrated database retrieval system