KEGG   Pandoraea pnomenusa DSM 16536: LV28_09395Help
Entry
LV28_09395        CDS       T03411                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ppnm  Pandoraea pnomenusa DSM 16536
Pathway
ppnm00480  Glutathione metabolism
ppnm00590  Arachidonic acid metabolism
ppnm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppnm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    LV28_09395
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LV28_09395
Enzymes [BR:ppnm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LV28_09395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AIU26731
UniProt: A0A378YJE4
Position
1080947..1081444
Genome map
AA seq 165 aa AA seqDB search
MSATSQQVYDFSVQTLSGETVSLAQYRGKVLLIVNTASECGFTPQYAGLQALYEALAPRG
FEVLAFPCNQFGKQEPGDAQAIRSFCDLRFHITFPMFAKIDVKGPDAAPLYRFLTQEKPG
VLGTKAIKWNFTKFLVDPRGNVVARYAPSAKPETLRADIERLLAV
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgacttcgcagcaggtgtacgacttttcggtccagacgctgtccggcgagacg
gtcagtctcgcgcaatatcgcggcaaggtgctgctcatcgtcaacacggccagcgaatgc
gggttcacgccgcaatacgccggattgcaggcgttgtacgaagcgctcgcgccgcgcggc
ttcgaagtactcgcgtttccgtgcaaccagttcggcaagcaggagcccggtgacgcccag
gcgattcgcagcttctgcgatctgcgctttcacatcacgttcccgatgttcgccaagatc
gacgtgaaggggccggatgccgcccccctgtaccgctttctcactcaggagaagcccggc
gtgctcggcacgaaggccatcaagtggaatttcacgaagtttcttgtcgacccgcggggg
aacgtggtggcgcgctacgcgccgagcgcgaaacccgagaccctgcgcgccgatatcgag
cggctgctggccgtctga

DBGET integrated database retrieval system