KEGG   Pandoraea pnomenusa DSM 16536: LV28_14360Help
Entry
LV28_14360        CDS       T03411                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
ppnm  Pandoraea pnomenusa DSM 16536
Pathway
ppnm00790  Folate biosynthesis
ppnm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppnm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LV28_14360
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppnm04147]
    LV28_14360
Enzymes [BR:ppnm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     LV28_14360
Exosome [BR:ppnm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LV28_14360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AIU27565
UniProt: A0A378YNS5
Position
complement(22115..22420)
Genome map
AA seq 101 aa AA seqDB search
MTTRLSSEARASLAEVLPEWHQVVGRDAIQRSFTFHDFREAFGFMVQVALSAEKMNHHPE
WFNVYNRVDITLSTHDADGLTQRDIDLAREIDQFAGDRASS
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacgactctcttccgaggcacgcgcgagcctggccgaagtgctgcccgagtgg
caccaggtggtcggccgcgacgccatccagcgcagtttcacgtttcacgacttcagggaa
gccttcggcttcatggttcaggtcgcattgagcgccgagaagatgaatcatcatcccgag
tggttcaacgtctacaaccgtgtggacattacgctctcgacgcacgacgccgacggcctg
acccagcgcgacatcgatctcgcacgtgaaatcgaccagttcgccggcgaccgcgcctcg
agctga

DBGET integrated database retrieval system