KEGG   Pandoraea pnomenusa DSM 16536: LV28_15685Help
Entry
LV28_15685        CDS       T03411                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
ppnm  Pandoraea pnomenusa DSM 16536
Pathway
ppnm00670  One carbon pool by folate
ppnm01100  Metabolic pathways
ppnm01120  Microbial metabolism in diverse environments
ppnm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppnm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    LV28_15685
Enzymes [BR:ppnm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     LV28_15685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR Fe-ADH
Motif
Other DBs
NCBI-ProteinID: AIU27793
UniProt: A0A378YPV7
Position
complement(5120339..5121169)
Genome map
AA seq 276 aa AA seqDB search
MTQPSFSFEFFPPKTADGAEKLRATRQQLFPLGPKFVSVTFGAGGSTQQGTLDTVVEIQR
EGVEAAPHLSCVGSTRENIREILQTYRQHGIRHIVALRGDLPSGMGEIGEFRYASELVEF
IRAETGDWFHVEVAAYPEYHPQARSPRLDLEHFANKVKAGANAAITQYFFNADAYFRFVD
DVARLGVQVPIVPGIMPITNYSQMMRFSEMCGAEVPRWIAKRLEGFGDDREAIRAFGLDV
VTGLCERLLAGGAPGLHFYTLNAASATKAMWQRLGL
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaccttccttcagtttcgaattcttcccgcccaagacggccgatggcgcggag
aagctgcgcgccacgcgtcagcagctgttcccgctcgggcccaagttcgtctccgtgacg
ttcggcgccggcggttcgacccagcagggcacgctcgacaccgtcgtcgaaatccagcgc
gaaggcgtggaggccgcgccgcacctgtcgtgcgtgggttcgacccgcgagaacattcgc
gagatcctgcagacgtatcgtcagcacggcatccgccacatcgtggcgctgcgcggcgac
ctgccctcgggcatgggcgagatcggcgaatttcgttatgcgtcggagctcgtggagttt
atccgcgccgagaccggcgactggttccacgtcgaggtggctgcctacccggaataccat
ccgcaggcgcgctcgccccgtctggacctggagcatttcgccaacaaggtgaaagccggg
gccaacgccgcgatcacgcagtacttcttcaatgcggatgcgtatttccggttcgtcgac
gacgtggcgcgcctgggcgtgcaggtgccgatcgtgccgggcatcatgcccatcacgaac
tactcgcagatgatgcgtttctcggaaatgtgcggcgccgaagtgccgcgctggatcgcc
aagcgcctggagggcttcggcgatgatcgcgaggcgatccgcgccttcgggctcgacgtg
gtgaccggactttgcgagcgtctgctcgccggcggggcgcccgggttgcacttctatacg
ctcaacgcggcatcggcgaccaaggcgatgtggcagcgtctcggcctctaa

DBGET integrated database retrieval system