KEGG   Pandoraea pnomenusa DSM 16536: LV28_20400Help
Entry
LV28_20400        CDS       T03411                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
ppnm  Pandoraea pnomenusa DSM 16536
Pathway
ppnm00030  Pentose phosphate pathway
ppnm00480  Glutathione metabolism
ppnm01100  Metabolic pathways
ppnm01110  Biosynthesis of secondary metabolites
ppnm01120  Microbial metabolism in diverse environments
ppnm01200  Carbon metabolism
Module
ppnm_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:ppnm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LV28_20400
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LV28_20400
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppnm04147]
    LV28_20400
Enzymes [BR:ppnm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     LV28_20400
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     LV28_20400
Exosome [BR:ppnm04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   LV28_20400
  Exosomal proteins of colorectal cancer cells
   LV28_20400
  Exosomal proteins of bladder cancer cells
   LV28_20400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AIU28609
UniProt: A0A378YWY5
Position
complement(4133509..4135002)
Genome map
AA seq 497 aa AA seqDB search
MHTPSPYTFVLFGATGDLSLRKVLPSLFRAFRTGQLGSDGRADASDATATGRILAVSRKP
MDAAGYHTWCEEHVRGHIKPDVWDEAAWKQFLATIDYMPLDLGRQAEFDVLAGRLAKRPG
VRIFYLATGPSLFIPICEGLRRAGLNENGRIVLEKPLGHDLASSEAINDAVGAIFREDQI
YRIDHYLGKEAVQNLLALRFGNAIFEPLWRRDLIENIQITIAEEIGVEGRGEFYEQTGAL
RDMVQNHLLQLLAIVAMEPPLSMDADAVRDEKLRVLRSLRRLDDESVARNVVRGQYGGGA
IGKSAVSAYVDEPGVPADSQTETFVALKADIDNWRWAGVPFFLRTGKRLGERVAEIVVNY
RATPYPLLGEATTHPGVNRLVIRLQPNESIRLYCLAKQPGEGMNLQSVHLDLAFDQFFKG
HRMDAYERLLLDVIHGRLALFVRRDEQEQAWRWVAPIQAYWARQHKGPKRYAAGTWGPPA
ASALLTQYGTSWVEEDN
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgcatacgccttcaccctatacttttgtgttgttcggtgccaccggcgatttgtcgctg
cgcaaggtactcccttcgttgttccgggcgttccgcaccgggcagctcgggtccgacggc
cgggccgatgcctcggacgcgactgccaccggccgcattctggccgtctcccgcaaaccg
atggatgccgccggctaccacacctggtgcgaagagcacgtgcgaggccatatcaagccc
gacgtgtgggacgaggcggcgtggaagcagtttctggcgacgatcgattacatgccgctc
gatctcgggcgccaggcggaattcgacgtgctggccggacggctggcgaagcggcccggc
gtgcgcatcttctatctggccaccgggccgtcgttattcattccgatttgtgaagggctg
cgaagggcggggctcaacgagaacgggcgcatcgtgctcgagaagccgctgggccacgat
ctcgcatcgtccgaggcgatcaacgacgccgtgggcgcgatcttccgcgaagaccagatt
taccgcatcgaccattacctcgggaaggaggcggtgcagaacctgctcgcgctgcgtttc
ggcaatgcgattttcgaaccgctgtggcggcgtgacctgatcgagaacatccagatcacg
atcgcggaggagatcggggtggaggggcgcggcgagttctatgagcagaccggcgcgctg
cgcgacatggtgcagaaccacctgctgcaactgctcgccatcgtggcgatggagccgccg
ttgtcgatggacgccgacgccgtgcgcgacgagaagcttcgcgtgctgcgttcgctgcgc
cggcttgacgacgagtcagtggcccgcaacgtggtgcgcggccaatacggcggcggggcc
atcggcaagtcggccgtatccgcttacgtggacgagccgggggtgcccgccgacagccag
accgaaacgttcgtggccctgaaggccgacatcgacaactggcgctgggccggcgtgccg
tttttcctgcgcacgggcaagcggctgggcgaacgtgtggcggagatcgtcgtcaactat
cgggccacgccgtatccgttgctcggcgaggcaacgacgcaccccggcgtgaaccgtctc
gtcatccgtctgcagccgaacgaatcgatccgcctctactgtctggcgaagcaaccgggt
gagggaatgaacctgcaatcggttcacctcgatctcgcgttcgatcagttcttcaaaggg
caccgcatggatgcctacgagcgcttgttgctcgacgtcatccacgggcgcctggccctg
ttcgtacgacgtgacgagcaggaacaggcctggcgctgggtcgcgccgatccaggcgtac
tgggcgcgccagcacaagggtccgaagcgctacgccgccggcacctgggggccgcccgcc
gcgagcgcgctgctcacgcagtacggcacgagctgggtggaagaagacaactga

DBGET integrated database retrieval system