KEGG   Pandoraea pnomenusa DSM 16536: LV28_21050Help
Entry
LV28_21050        CDS       T03411                                 

Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
ppnm  Pandoraea pnomenusa DSM 16536
Pathway
ppnm00860  Porphyrin and chlorophyll metabolism
ppnm01100  Metabolic pathways
Module
ppnm_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:ppnm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LV28_21050
Enzymes [BR:ppnm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     LV28_21050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 MobB BPL_N
Motif
Other DBs
NCBI-ProteinID: AIU28722
UniProt: A0A378YXI0
Position
complement(3987771..3989297)
Genome map
AA seq 508 aa AA seqDB search
MSEIPVNFRAPAVGRRGTLMIQGTSSDAGKSTLVAGLCRLLHREGVRVAPFKPQNMALNS
AVTADGGEIGRAQALQAQAAGVAPHTDFNPVLLKPSSDRGAQVIIGGKVVADLDARAYHE
YKPRAMAAVLAAYERLRHGYDAVLVEGAGSPAEVNLRARDIANMGFAEAVDAPVLLVADI
DRGGVFAQLVGTLACLSDSERARIQGFVINRFRGDPSLLASGLEWVAARTGIPVLGVLPY
LQGLHLDGEDMLPGERHAAASGETRLRVAVPALPRISNHTDFDALRAHPQVDFRYVGAGE
PWPASDLVVLPGSKHVRADLAWLRAQGWAPAIARHLRYGGKVLGICGGLQMLGTWIHDPL
GVEGEAGSTAGLGWLEIETTMAASKQLRVVSGRLSAGHAPVSGYEIHMGVTHGAALERPA
LWLTREGGDGTDASVVADGARSADDQVMGTYVHGLFDTPQALAALLTWAGARDAAMLDYN
ALREASLERLADSLATHLDLARVWRCLR
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaatccctgtcaatttccgcgcgcctgccgtcggtcgccgcggcaccctgatg
attcagggcacgtcgtcggacgcgggcaagagcaccctggtggccgggctgtgccgcctg
ctgcatcgcgagggcgtgcgggtcgcgccgttcaagccgcagaacatggcgctcaacagc
gcggtgacggccgacggcggcgagatcggacgcgcccaggcgcttcaggcgcaggctgcc
ggcgtggcgccgcacaccgacttcaatcccgtgctgctcaagccgagcagcgatcgcggt
gcgcaggtgatcatcggcggcaaggtcgtggccgatctcgatgcccgcgcctatcacgag
tacaagccacgggcgatggcggccgtgctcgccgcctacgagcgcctgcgccacggctac
gacgccgtgctcgtcgaaggcgcgggaagtccggccgaagtgaatctgcgcgcccgggac
atcgccaacatggggttcgccgaagccgtcgacgcgccagtgctgctcgtggccgacatt
gaccgcggcggcgtgttcgcccaactggtcggcacgctggcctgtctgtcggacagcgag
cgcgcacgtatccagggattcgtcatcaatcggtttcgcggcgatccgtcattgctcgcc
agcggtctggaatgggtggcggcccgcacgggcatcccggtgctcggcgtgctgccgtat
cttcaggggctgcatctggacggggaggacatgctgccgggcgagcgtcacgcggccgcg
agcggcgagacgcgtctgcgcgtggcggtgccggcgttgccccgaatcagcaatcacacg
gatttcgacgccttgcgggcgcacccgcaggtcgactttcgctatgtcggcgccggagag
ccgtggccggcgagcgatctcgtggtcctgccgggcagcaagcacgtgcgcgcggatctc
gcctggttgcgtgcccagggctgggcgccggcgatcgcgcgtcatctgcgctacggcggc
aaggtgctcggcatttgcggcggactgcaaatgctgggtacgtggattcacgacccgctc
ggtgtcgagggcgaagcgggctccacggccggtctcggctggctggagatcgagacgacg
atggcggcgagcaagcaattgcgcgtggtgagcgggcggctgagcgcaggtcatgccccg
gtgagcggctatgagatccacatgggcgtcacccatggggcggcgctcgagcggcccgcc
ctctggctcacgagggaagggggcgacggcacggacgcctcggtggttgccgacggcgcg
cgctcggccgacgaccaggtcatgggcacgtacgtgcacggcctgttcgacacaccgcag
gcgctcgccgcactgctgacgtgggcgggggcccgggacgcggcgatgctggattacaac
gcgctgcgagaggcgtcgctcgagcggctggccgattcgctggcgacgcatctggatctg
gcccgcgtgtggcgctgcctgcgctga

DBGET integrated database retrieval system