KEGG   Pandoraea pnomenusa RB38: DA70_01735Help
Entry
DA70_01735        CDS       T03067                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
ppno  Pandoraea pnomenusa RB38
Pathway
ppno00564  Glycerophospholipid metabolism
ppno01100  Metabolic pathways
ppno01110  Biosynthesis of secondary metabolites
Module
ppno_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:ppno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DA70_01735
Enzymes [BR:ppno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     DA70_01735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: AHN73323
Position
complement(3211340..3211975)
Genome map
AA seq 211 aa AA seqDB search
MHYPHPIIAREGWPFLGVAVGIALVVHFMSGVLWAAPFWVIALFVLQFFRDPPREVPQQS
GAVLSPADGRVVAIETTQDTYAGREALKISVFMNVFNVHSNRAPVDGTVTKVEYFPGRFL
NADLDKASLENERNALVIDVGGQIVTSVQVAGLIARRILCYVKAGDTLARGQRYGFIRFG
SRVDVYLPLGSRPRVAIGDKVSATSTILAEL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcattatccacacccgatcattgcccgcgagggctggccctttctgggtgtcgccgtt
ggcatcgcgctcgtggtgcatttcatgtccggggtgttgtgggccgcgccgttctgggtg
atcgccctgttcgtcctgcagttcttccgtgatccgccgcgcgaggtgccgcagcagtcg
ggggccgtgctctcgccggccgacggccgggtcgtggcgatcgaaaccacacaggacacc
tacgcaggtcgtgaagcgctgaagatcagcgtattcatgaacgtcttcaacgtgcactcg
aatcgtgctccggttgacggcacggtgaccaaggtggaatatttccccgggcgtttcctc
aatgccgatctcgacaaggcatcgctcgagaacgaacgcaacgccctggtgatcgacgtg
ggtggccagatcgtcacgagcgttcaggtggcgggactcattgcccgccgcattctttgc
tacgtcaaggcaggcgatacgctcgcgcgcggtcagcgatacggtttcatccgtttcggt
tcacgcgtcgacgtatacctgccgctggggtcgcgcccgcgcgtggccatcggcgacaag
gtgtcggccacgtcgacgatcctcgccgaactgtaa

DBGET integrated database retrieval system