KEGG   Pandoraea pnomenusa RB38: DA70_02455Help
Entry
DA70_02455        CDS       T03067                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppno  Pandoraea pnomenusa RB38
Pathway
ppno00071  Fatty acid degradation
ppno00072  Synthesis and degradation of ketone bodies
ppno00280  Valine, leucine and isoleucine degradation
ppno00310  Lysine degradation
ppno00362  Benzoate degradation
ppno00380  Tryptophan metabolism
ppno00620  Pyruvate metabolism
ppno00630  Glyoxylate and dicarboxylate metabolism
ppno00640  Propanoate metabolism
ppno00650  Butanoate metabolism
ppno00900  Terpenoid backbone biosynthesis
ppno01100  Metabolic pathways
ppno01110  Biosynthesis of secondary metabolites
ppno01120  Microbial metabolism in diverse environments
ppno01130  Biosynthesis of antibiotics
ppno01200  Carbon metabolism
ppno01212  Fatty acid metabolism
ppno02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DA70_02455
   00630 Glyoxylate and dicarboxylate metabolism
    DA70_02455
   00640 Propanoate metabolism
    DA70_02455
   00650 Butanoate metabolism
    DA70_02455
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DA70_02455
   00072 Synthesis and degradation of ketone bodies
    DA70_02455
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DA70_02455
   00310 Lysine degradation
    DA70_02455
   00380 Tryptophan metabolism
    DA70_02455
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DA70_02455
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DA70_02455
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DA70_02455
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppno04147]
    DA70_02455
Enzymes [BR:ppno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DA70_02455
Exosome [BR:ppno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DA70_02455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III Alk_phosphatase SpoVAD
Motif
Other DBs
NCBI-ProteinID: AHN73439
UniProt: V5UL88
Position
complement(3057054..3058235)
Genome map
AA seq 393 aa AA seqDB search
MSDIVIVSAARTAVGKFGGSLAKVAAPDLGAIVIDEVLKRAKLKGEDVSEVIMGQVLTAG
SGQNVARQASIKAGLPAMVPAMTINKVCGSGLKAVMLAANAISAGDADIVVAGGQENMSA
APHVLPGSRDGFRMGDAKLIDTMIVDGLWDVYNQYHMGITAENVAKEYGITREMQDAFAA
ASQNKAEAAQKAGRFDDEIVPVSIPQRKGDPLVFKTDEFVRHGVTAEALAGLKPAFAKDG
TVTAANASGINDGAAAVVVMSAKRAEQLGLTPLARIVAYANAGVDPKVMGIGPVPASQRC
LSRAGWKASDLDLMEINEAFAAQALAVNQQMGWDTSKINVNGGAIAIGHPIGASGCRILV
TLLHEMARRDARRGLASLCIGGGMGVALAVERV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatatcgtgattgtgtcggctgcgcgcactgcggtcggtaagtttggcggttcg
cttgccaaggtggcggcgccggatctgggggctatcgtgatcgatgaggtcctcaagcgt
gcgaagctcaagggtgaagacgtcagcgaagtcatcatggggcaggtgctcacggccggc
tcgggccagaatgtggcgcgtcaggcttcgatcaaggccgggctgcccgccatggtgccg
gccatgaccatcaacaaggtgtgcggctcgggcctgaaggccgtgatgctggccgccaac
gcgatcagcgccggggacgccgacatcgtcgtggccggcggccaggaaaacatgagtgcc
gcgccgcacgtgctcccgggctcgcgcgacggcttccgcatgggcgacgccaagctgatc
gatacgatgatcgtcgacggcctgtgggacgtctacaaccagtaccacatgggcatcact
gccgagaacgtcgccaaggaatacggcatcacgcgcgagatgcaggacgcctttgcggcc
gcatcgcaaaacaaggcggaagcggcgcagaaagcaggccgcttcgacgacgagatcgtg
ccggtctcgattccgcagcgcaagggcgacccgctggtgttcaagaccgacgaattcgtg
cgtcacggcgtgaccgccgaagcgctggccggtctgaagccggcgttcgcgaaggacggc
acggtcaccgccgccaatgcgtcgggcatcaacgacggcgctgccgcggtggtggtgatg
tcggccaagcgcgccgagcagcttggcctcacgccgcttgcgcgcatcgtcgcgtatgcc
aacgccggcgtggatccgaaggtgatggggatcggcccggtgccggcctcgcagcgctgc
ctgtcgcgtgccggctggaaggcgagcgatctggatctgatggaaatcaacgaagcgttc
gcggcgcaggcgttggccgtgaaccagcaaatgggctgggacacgtccaagatcaacgtg
aacggtggcgcgatcgccatcggtcacccgattggcgcgtcgggctgccgtattctggtg
acgttgttgcatgaaatggcacgtcgcgacgcgcgtcggggtctggcatcgctgtgcatc
ggcggcggcatgggcgtggcgctggcggtcgagcgcgtctga

DBGET integrated database retrieval system