KEGG   Pandoraea pnomenusa RB38: DA70_10040Help
Entry
DA70_10040        CDS       T03067                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
ppno  Pandoraea pnomenusa RB38
Pathway
ppno00860  Porphyrin and chlorophyll metabolism
ppno01100  Metabolic pathways
Module
ppno_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:ppno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DA70_10040
Enzymes [BR:ppno01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     DA70_10040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 MobB MeaB BPL_N
Motif
Other DBs
NCBI-ProteinID: AHN74759
Position
1368820..1370346
Genome map
AA seq 508 aa AA seqDB search
MSEIPVNFRAPAVGRRGTLMIQGTSSDAGKSTLVAGLCRLLHREGVRVAPFKPQNMALNS
AVTADGGEIGRAQALQAQAAGVAPHTDFNPVLLKPSSDRGAQVIIGGKVVADLDARAYHE
YKPRAMAAVLAAYERLRHGYDAVLVEGAGSSAEVNLRARDIANMGFAEAVDAPVLLVADI
DRGGVFAQLVGTLACLSDSERARIQGFVINRFRGDPSLLASGLEWVAARTGIPVLGVLPY
LQGLHLDGEDMLPGERHAAASGETRLRVAVPAFPRISNHTDFDALRAHPQVDFRYVGAGE
PWPASDLVILPGSKHVRADLAWLRAQGWAPAIARHLRYGGKVLGICGGLQMLGTWIHDPL
GVEGEAGSTAGLGWLEIETTMAASKQLRVVSGRLSAGHAPVSGYEIHMGVTHGAALERPA
LWLTREGGDGTDASVVADGARSADDQVMGTYVHGLFDTPQALAALLTWAGARDAAMLDYN
ALREASLERLADSLATHLDLARVWRCLR
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaatccctgtcaatttccgcgcgcctgccgtcggtcgccgcggcaccctgatg
attcagggcacgtcgtcggacgcgggcaagagcaccctggtggccgggctgtgccgcctg
ctgcatcgcgagggcgtgcgggtcgcgccgttcaagccgcagaacatggcgctcaacagc
gcggtgacggccgacggcggcgagatcggacgcgcccaggcgcttcaggcgcaggctgcc
ggcgtggcgccgcacaccgacttcaatcccgtgctgctcaagccgagcagcgatcgcggt
gcgcaggtgatcatcggcggcaaggtcgtggccgatctcgatgcccgcgcctatcacgag
tacaagccacgggcgatggcggccgtgctcgccgcctacgagcgcctgcgccacggctac
gacgccgtgctcgtcgaaggcgcgggaagttcggccgaagtgaatctgcgcgcccgggac
atcgccaacatggggttcgccgaagccgtcgacgcgccagtgctgctcgtggccgacatt
gaccgcggcggcgtgttcgcccaactggtcggcacgctggcctgtctgtcggacagcgag
cgcgcacgtatccagggattcgtcatcaatcggtttcgcggcgatccgtcattgctcgcc
agcggtctggaatgggtggcggcccgcacgggcatcccggtgctcggcgtgctgccgtat
cttcaggggctgcatctggacggggaggacatgctgccgggcgagcgtcacgcggccgcg
agcggcgagacgcgtctgcgcgtggcggtgccggccttcccccgaatcagcaatcacacg
gatttcgacgccttgcgggcgcacccgcaggtcgactttcgctatgtcggcgccggagag
ccgtggccggcgagcgatctcgtgatcctgccgggcagcaagcacgtgcgcgcggatctc
gcctggttgcgtgcccagggctgggcgccggcgatcgcgcgtcatctgcgctacggcggc
aaggtgctcggcatttgcggcggactgcaaatgctgggcacgtggattcacgacccgctc
ggtgtcgagggcgaagcgggctccacggccggtctcggctggctggagatcgagacgacg
atggcggcgagcaagcaattgcgcgtggtgagcgggcggctgagcgcaggtcatgccccg
gtgagcggctatgagatccacatgggcgtcacccatggggcggcgctcgagcggcccgcc
ctctggctcacgagggaagggggcgacggcacggacgcctcggtggttgccgacggcgcg
cgctcggccgacgaccaggtcatgggcacgtacgtgcacggcctgttcgacacaccgcag
gcgctcgccgcactgctgacgtgggcgggggcccgggacgcggcgatgctggattacaac
gcgctgcgagaggcgtcgctcgagcggctggccgattcgctggcgacgcatctggatctg
gcccgcgtgtggcgctgcctgcgctga

DBGET integrated database retrieval system