KEGG   Pandoraea pnomenusa RB38: DA70_10170Help
Entry
DA70_10170        CDS       T03067                                 

Definition
(GenBank) ADP-L-glycero-D-mannoheptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
ppno  Pandoraea pnomenusa RB38
Pathway
ppno00540  Lipopolysaccharide biosynthesis
ppno01100  Metabolic pathways
Module
ppno_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:ppno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    DA70_10170
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ppno01005]
    DA70_10170
Enzymes [BR:ppno01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     DA70_10170
Lipopolysaccharide biosynthesis proteins [BR:ppno01005]
 Unusual sugar
  DA70_10170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 KR NAD_binding_10 DapB_N adh_short
Motif
Other DBs
NCBI-ProteinID: AHN74784
UniProt: A0A378YX86
Position
1342649..1343653
Genome map
AA seq 334 aa AA seqDB search
MTIIVTGAAGFIGANLVKALNERGETDIVAVDNLTRADKFRNLVDCEISDYLDKTDFVAR
FQRREFGRVRAIFHEGACSDTMETDGRYMMENNFRYTRALFEACQTQTVPFLYASSAATY
GASETFVESREYEKPLNVYGYSKFLFDQIVRRAMREAGGKLPSQVAGFRYFNVYGPREAH
KGRMASVAFHNFNEFRANGRVKLFGEYNGYAAGTQSRDFVSVEDVVKVNLHFFDHPERSG
IFNLGTGRAQPFNDIAVAVINTLREEAGEAPLSLDEMVRQGLVEYIPFPDALRGKYQCFT
QASVEHLRQAGGYQQPFYTVGEGVSRYVRWLLAQ
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcatcgtcaccggcgccgccggtttcatcggcgcgaacctcgtcaaagccctc
aacgagcgcggcgagaccgacatcgtggcggtcgacaacctcacacgcgccgacaaattc
cgcaatctggtcgattgcgaaatcagcgactacctcgacaagaccgatttcgtcgcgcgt
ttccagcgccgcgagttcggtcgcgtgcgcgcgattttccatgaaggcgcctgctccgac
acgatggagaccgacggccgctacatgatggagaacaacttccgctacacgcgcgcgttg
ttcgaggcgtgccagacgcagacggtgccgttcctctacgcgtcttccgcggcgacgtac
ggcgcctcggaaacgttcgtggaatcgcgcgagtacgagaagcccctcaacgtctacggg
tactcgaaattcctcttcgaccagatcgtgcgtcgcgccatgcgcgaggcgggtggcaag
ctgccgagccaggtggcggggtttcgctacttcaacgtgtacggcccgcgcgaagcgcac
aaggggcgcatggcctcggtggcgttccacaacttcaacgagttccgcgccaacggccgc
gtgaagctctttggcgagtacaacggctatgcggcgggcacgcaaagtcgcgacttcgtg
tccgtcgaggacgtggtcaaggtgaatctgcacttcttcgatcatcccgagcgaagcggc
atcttcaacctcggcacgggccgcgcgcagccgttcaatgacattgcggtcgccgtgatc
aacacgttgcgcgaagaggccggcgaggcgccgctctcgctcgacgagatggtgcggcag
gggctcgtcgagtacatcccgttcccggacgcgctgcgtggcaagtatcagtgcttcacc
caggcgagcgtcgagcatctgcgccaggcgggtgggtatcagcagccgttctatacggtc
ggtgagggcgtctcgcgctacgtgcgctggctgttggcccaatag

DBGET integrated database retrieval system