KEGG   Pandoraea pnomenusa RB38: DA70_13310Help
Entry
DA70_13310        CDS       T03067                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppno  Pandoraea pnomenusa RB38
Pathway
ppno00071  Fatty acid degradation
ppno00072  Synthesis and degradation of ketone bodies
ppno00280  Valine, leucine and isoleucine degradation
ppno00310  Lysine degradation
ppno00362  Benzoate degradation
ppno00380  Tryptophan metabolism
ppno00620  Pyruvate metabolism
ppno00630  Glyoxylate and dicarboxylate metabolism
ppno00640  Propanoate metabolism
ppno00650  Butanoate metabolism
ppno00900  Terpenoid backbone biosynthesis
ppno01100  Metabolic pathways
ppno01110  Biosynthesis of secondary metabolites
ppno01120  Microbial metabolism in diverse environments
ppno01130  Biosynthesis of antibiotics
ppno01200  Carbon metabolism
ppno01212  Fatty acid metabolism
ppno02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppno00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DA70_13310
   00630 Glyoxylate and dicarboxylate metabolism
    DA70_13310
   00640 Propanoate metabolism
    DA70_13310
   00650 Butanoate metabolism
    DA70_13310
  Lipid metabolism
   00071 Fatty acid degradation
    DA70_13310
   00072 Synthesis and degradation of ketone bodies
    DA70_13310
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DA70_13310
   00310 Lysine degradation
    DA70_13310
   00380 Tryptophan metabolism
    DA70_13310
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DA70_13310
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DA70_13310
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    DA70_13310
Enzymes [BR:ppno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DA70_13310
Exosome [BR:ppno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DA70_13310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHN75328
Position
627561..628745
Genome map
AA seq 394 aa AA seqDB search
MDQLDPVVIISAVRTPLGRFGGNFSAVSAPELGAHAIRAAVERAGLDREKIDESFMGCVL
AAGIGQAPARQALRAAGLSDATGATTVNKVCGSGMKAIMIGHDLLLAGSANFVLSGGMES
MSSAPYLLPGARGGYRMGHNQVVDHMLLDGLEDAYEKGRSMGDFGEAAAERFGFDRLQQD
EYALETLMRARNAIESGAFSDEIAPVTVLDKGVPRLIAHDEHPLKVSPDKIRSLPPAFRP
NGTITAASASSNSDGAAALVLSRRSIAEREGLPVLATIRAHATFSHDPAWYTTAPIPAIR
KLLDKAAWDIGDVDLFEINEAFAVVAMAAAKELAIPRDRLNVNGGACALGHPIGATGARM
VVTLLHALRRRRLRRGVAALCIGGGEATAIAVEV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggaccaactggatccggttgtcattatttccgcagtgcgcactccgttggggagattc
ggggggaatttctcggcggtcagtgctcccgagttgggcgcacacgccattcgcgccgcc
gtggaacgcgcaggtctcgatcgcgagaagatcgatgagagtttcatgggatgtgttctc
gcggccggcattggacaagccccggctcgccaggcattgcgcgcggcggggctatcggac
gcgaccggggcgaccacggtgaacaaggtctgtggctcgggtatgaaggccatcatgatt
ggacacgacctgctgctcgccggctcggcgaactttgtgttgagcggcgggatggagtcg
atgtcgagcgcgccgtatttgctgccgggcgcgcggggcggatatcgcatggggcacaac
caggtggtcgatcacatgcttctggatggcctggaagacgcctacgaaaaagggcgatcg
atgggcgatttcggggaggccgcggcggagcggtttgggttcgatcgcttgcaacaggac
gagtacgccttggagacattgatgcgagctcgcaatgccatcgaaagtggtgcattttcc
gatgaaatcgcaccggtcacggtcctcgacaagggggtgccgcgactgattgcccacgac
gaacaccccctgaaggtgtcgcccgataaaatccggtcgttgccgccagcctttcgtccg
aacggcacgattaccgcggcgagcgcttcctccaatagtgatggcgcagcggcgctggtc
ctgtcgcgacgctcgatcgccgagcgggagggactgcccgttcttgcgacaatccgcgcg
cacgcgacgttcagccatgatcctgcctggtacacgacggcgccaatccccgcaattcgg
aagttgctcgacaaggccgcgtgggacatcggcgatgtggacttgttcgagatcaacgaa
gccttcgccgtagttgccatggcggcggcaaaggagttggcgattcctcgtgatcggttg
aatgtcaacgggggcgcatgcgccttggggcatccgatcggtgcgacaggcgcacgtatg
gttgtcacactgctgcacgcactgcgtcgtcggcgtcttcgacgcggtgtcgcggcgttg
tgcattggcggaggcgaggctaccgcgattgctgtcgaggtgtag

DBGET integrated database retrieval system