KEGG   Paenibacillus polymyxa M1: PPM_0161Help
Entry
PPM_0161          CDS       T01968                                 

Gene name
glcK1
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
ppo00010  Glycolysis / Gluconeogenesis
ppo00052  Galactose metabolism
ppo00500  Starch and sucrose metabolism
ppo00520  Amino sugar and nucleotide sugar metabolism
ppo00521  Streptomycin biosynthesis
ppo01100  Metabolic pathways
ppo01110  Biosynthesis of secondary metabolites
ppo01120  Microbial metabolism in diverse environments
ppo01130  Biosynthesis of antibiotics
ppo01200  Carbon metabolism
Module
ppo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ppo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPM_0161 (glcK1)
   00052 Galactose metabolism
    PPM_0161 (glcK1)
   00500 Starch and sucrose metabolism
    PPM_0161 (glcK1)
   00520 Amino sugar and nucleotide sugar metabolism
    PPM_0161 (glcK1)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PPM_0161 (glcK1)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PPM_0161 (glcK1)
Enzymes [BR:ppo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PPM_0161 (glcK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: CCC83098
Position
204689..205639
Genome map
AA seq 316 aa AA seqDB search
MSESIYVGVDLGGTAIKVGICNENGQLLHTYEGPTETDKGVDVVIGNIEKYVRHIVEESP
YEWDQLKGVGAGVAGFTNVRDGIIVLAPNIGFRDVPIRALLENRIGKPVKIDNDANVAAL
GEAWAGAGKGIENCVCYTLGTGVGGGIIINGKIYQGSSGMAGEIGHISVVPDLEAIQCGC
GKMGCLETVSSATGIIRMAKDAVERGDRTSLALEDHIAAKEVFDAAKAGDEVALRIVNRA
AFYLGKSMAAVAAVLNPELFIIGGGVSKAGDFLFEEMRRVYAKLAPEPLQKGVYIVPAVL
GNDAGIVGAAGLLLRS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaagtatctatgtaggtgtcgatttgggcggtaccgcgattaaagtcggcatt
tgtaatgaaaacggacagcttttgcacacatatgagggaccaaccgaaaccgataaaggt
gtagacgttgtcattggtaatatcgaaaaatatgtgcggcacattgttgaggaatctcct
tatgagtgggatcaactaaagggtgtcggtgcaggcgttgcaggttttacgaatgttcgt
gatggtattattgtcctcgctcctaatattggctttcgtgacgtaccgatccgtgcgctc
ctagagaaccggattggcaagcctgtgaaaatagacaatgatgcgaatgttgctgcgctg
ggtgaggcttgggctggtgcaggcaaaggcattgagaactgcgtatgttataccctggga
acaggcgtaggtggcggtattattataaacggtaaaatatatcaaggttcttcgggcatg
gctggggaaattggccatatcagcgtcgtgcctgatctggaggctattcagtgtggatgc
ggcaaaatgggttgcttggaaactgtatcttccgcaacaggcatcattcgtatggccaag
gatgctgtggaacgtggcgaccggacctctctggcgctggaagatcacattgctgctaag
gaagtattcgatgctgctaaagccggggatgaagtcgcactgcgtatcgtgaatcgggct
gccttttatttggggaaatcgatggcagctgttgccgctgtgctcaatccagaattgttt
attataggcggcggtgtttctaaagcaggcgactttttgtttgaagagatgcgtcgcgta
tacgccaagctggctcctgaaccgcttcaaaaaggtgtatatatcgtaccagcagtgtta
ggcaatgacgcgggtatcgtaggggctgcagggttgctgctacgctcctaa

DBGET integrated database retrieval system