KEGG   Paenibacillus polymyxa M1: PPM_0308Help
Entry
PPM_0308          CDS       T01968                                 

Gene name
adhA
Definition
(GenBank) alcohol dehydrogenase I
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
ppo00010  Glycolysis / Gluconeogenesis
ppo00071  Fatty acid degradation
ppo00350  Tyrosine metabolism
ppo00625  Chloroalkane and chloroalkene degradation
ppo00626  Naphthalene degradation
ppo01100  Metabolic pathways
ppo01110  Biosynthesis of secondary metabolites
ppo01120  Microbial metabolism in diverse environments
ppo01130  Biosynthesis of antibiotics
ppo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ppo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPM_0308 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    PPM_0308 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    PPM_0308 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PPM_0308 (adhA)
   00626 Naphthalene degradation
    PPM_0308 (adhA)
Enzymes [BR:ppo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PPM_0308 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 2-Hacid_dh_C CdhD AlaDh_PNT_C Methyltransf_25 Methyltransf_31 ADH_N_2 TrkA_N Peptidase_M73 Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: CCC83245
Position
378707..379723
Genome map
AA seq 338 aa AA seqDB search
MKAAIVTKDKKVSVEEKPLRSLKHGEALVQVEYCGVCHTDLHVKNADFGDVTGRVLGHEG
IGKVIELGEGVTSLKVGDRVSIAWMFESCGHCEYCLTGRETLCREVKNAGYTVDGAMAEQ
CIVTADYAVKVPDNLDPAAASSVTCAGVTTYKAVKVSDIRPGQWIGIFGIGGLGNLAVQY
AKNVFNAKVVAFDISDEKLELAKKIGADYIVNSMKEDPVARAKELTNGAGLDATVVTAVA
KTPFNQAIDVVKAGARVVAVGLPTDKMDLDIPRLVLDGIQVIGSLVGTREDLKEAFQFAA
EGKVVPLVQKRPLEDINEIFEEMEHGKIQGRMVIDFTK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcgattgttacaaaagacaagaaagttagtgtagaagagaaacctttgcgc
tccctgaaacatggggaagcgttagtccaagttgaatattgcggggtttgccacacagat
ttacacgtaaaaaatgcagatttcggtgatgtcacaggcagagttctgggacatgaaggt
attgggaaagtcattgaattaggtgaaggagtaaccagccttaaagttggcgatcgcgta
agtattgcctggatgttcgaaagctgcggtcactgcgaatattgtttaaccggacgagaa
actttgtgtcgtgaagttaaaaatgccggatacacggtagatggtgcaatggcagaacaa
tgtattgtcacagctgactatgcggtcaaagtaccagataatcttgatcctgctgctgca
agcagtgtaacttgcgcaggggttacaacctataaagctgttaaagtgagtgatatcaga
ccaggacaatggatcggtatctttggtattggcggtttgggtaacctggctgtacaatac
gcaaaaaatgtgttcaatgctaaagttgtagcctttgacatcagtgatgaaaaactcgaa
ctggccaaaaaaattggtgctgactatattgttaacagcatgaaagaagatccagtcgcc
cgagctaaggaattaacgaacggtgctggtctggatgcaaccgtagttactgctgttgcc
aaaacacctttcaaccaagccattgacgttgtaaaggctggcgcgcgtgtcgtagctgta
ggtcttccaactgataagatggatctcgacattccgcgtctggttctggacggcattcaa
gtaatcggctccttggtcggtactcgtgaagaccttaaagaagcattccagttcgctgca
gaaggtaaagttgtacctcttgtacaaaaacgtccgcttgaagacatcaatgagatcttc
gaagagatggagcatggcaaaatccaaggacgtatggtcattgatttcacaaaataa

DBGET integrated database retrieval system