KEGG   Paenibacillus polymyxa M1: PPM_0551Help
Entry
PPM_0551          CDS       T01968                                 

Gene name
melA1
Definition
(GenBank) alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
ppo00052  Galactose metabolism
ppo00561  Glycerolipid metabolism
ppo00600  Sphingolipid metabolism
ppo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PPM_0551 (melA1)
  Lipid metabolism
   00561 Glycerolipid metabolism
    PPM_0551 (melA1)
   00600 Sphingolipid metabolism
    PPM_0551 (melA1)
Enzymes [BR:ppo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     PPM_0551 (melA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Melibiase_2 Glyco_hydro_31 GHL10
Motif
Other DBs
NCBI-ProteinID: CCC83488
Position
680112..682481
Genome map
AA seq 789 aa AA seqDB search
MPCTSYLKLIYDFCRTYCYIVGSYQALHHMNLVDACYIKILLSAFLVWISDDYYLREGLF
FPMAIIVQEQPGLFHLQSSGMSYIIQIVDGFPVHVYWGDRLKHREPMADLLLHTPTTAGL
DRLPQEYPQYGSGDFRTPAYQVELEDGTRITELKYDGYRIIKGKPSLPGLPAVYTENEAE
ADTLELELKDAFSGLKVVLLYTVFADRNVIARSARLSNEGEQSLRLLRALSASVDFSGKS
DLEFMYLSGAWAREGNITRKPILQGETRIDSKRGMSSHQLNPFTALVTQETTERHGEAFG
FSLVYSGGFEAGAELDSFGSTRFSIGVNSFDFSWLLSPGESFQTPEAVMVYSGQGLGEMS
RTYHRLYRTRLCRGTYRDEERPILVNNWEATYFDFNADKLVSIAKEGAELGIELFVLDDG
WFGKRDSDNSSLGDWYEDRRKLPDGLADVAKRINQLGLKFGLWFEPEMISPDSELYRKHP
DWCLHVPGRRRSEARWQLVLDYTRKEVRDYIYDSLAAIFSSAPVSYVKWDMNRCLTEIGS
AELPPERQSETAHRYVLGLYELLERVTTDFPHILFESCSSGGGRFDPGMLYYMPQVWTSD
NTDAVERLKIQYGTSLVYPVSATGAHVSAVPNHQVGRITPLDFRGDVAMSGNFGYELDLT
KFTDEEKETVKRQIAVYKQIRGLVQKGDLYRLKSPFEDNESAWMFVSEDQEDAIVYYFQV
MAVPNAPWRALRLDGLNPELEYEVQSGNSGQKSIHGGDRLMKLGLPLVYRQKDYESGWFR
LRALRSNKA
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgccatgtacttcatatctaaaattaatatatgatttctgtagaacctactgctatatt
gttggatcttatcaagctttacaccatatgaacttagttgacgcctgctacataaagatt
cttctaagtgcctttttggtgtggatctctgatgattattatctaagagaggggttattt
ttcccaatggctatcattgttcaagagcaaccggggctgtttcatttgcagtcgtcgggc
atgagttatattattcagattgtcgatggatttcctgtgcatgtatactggggagacagg
ttgaagcaccgtgagcccatggctgatcttttgcttcacactcctacgacggctggattg
gatcggctgccgcaagaatacccacagtatggaagtggagacttccgtaccccggcgtat
caagtagagctggaggatggaactcgcatcacggaattaaagtacgatggttaccggatt
attaagggaaagccatctctacctggccttccggccgtatataccgagaatgaagctgaa
gcggatacgttggaactggaattaaaagatgccttttcaggtcttaaagtggttcttctt
tatactgtttttgcggatcgaaacgtaatcgctcgttcggctcgtctaagtaatgagggg
gaacaaagtcttcgactcctccgtgcgctaagtgccagtgtcgatttctcggggaaaagc
gatttagagttcatgtatctttcgggagcatgggcacgggaagggaatattacccgcaaa
ccgatccttcaaggtgaaacccgaattgatagtaaaaggggcatgagcagtcaccaactt
aatccttttactgcattggtcacgcaggagacaacagaacgccatggtgaggcattcggc
tttagccttgtgtacagcgggggctttgaggctggcgcggaattagattcatttggctct
acccggtttagcattggtgtaaactcctttgacttttcatggttactgagcccaggggag
agcttccaaacgccagaagccgttatggtatactctggtcaaggactgggagaaatgtcg
cgtacatatcatcgcttgtatcgaactcggctttgccgagggacatatcgggatgaagaa
cgccctattctagtcaataactgggaagctacctattttgacttcaatgcagataagctg
gtatcgatagcgaaagagggggcagagctaggcatcgaactttttgtcttggatgacggt
tggttcggaaaacgggattctgacaattcgtctctcggtgattggtacgaggatcgtcgg
aagctgccagacggactggctgatgtcgcgaaacgtatcaatcaattggggcttaaattc
gggctctggttcgagccggagatgatctccccagacagtgagctgtaccggaagcatcca
gattggtgcctacacgttccaggacggcggcgcagcgaagccagatggcagctggtgctg
gactatactcgcaaggaagtacgcgattacatctacgattcgctagctgccattttctcc
agcgccccagtctcgtacgtgaaatgggatatgaatcgctgtctgacggaaattggttcc
gccgaactgccaccggagcgccaatctgagactgcccatcgctatgttcttggattgtat
gagctgctggagcgcgtcactaccgatttcccgcatattctttttgagagctgttcaagt
ggcggaggacgctttgacccaggcatgctttactacatgcctcaagtctggactagtgat
aataccgatgcggtggaacgcctgaagattcaatatggaactagccttgtctatcctgta
agcgccaccggagcgcatgtgtcagcagttccgaaccatcaagttggacgcataaccccc
cttgattttcgaggtgatgtggccatgtccggaaattttggatatgagcttgatctcacg
aaattcaccgatgaggaaaaagagacggtcaaacgccaaatcgcagtatataagcagata
cgtggcttagtacagaagggtgacttgtatcgcctaaagagcccgtttgaagataacgaa
tcggcttggatgtttgtttctgaagaccaagaggatgccatcgtctactatttccaagtg
atggctgttccgaacgcgccttggcgagccctgcgccttgatggactaaatccagagctt
gaatatgaagttcagtcaggaaatagcgggcaaaagtctatccatgggggggatcggctt
atgaagttgggcctccctcttgtctacagacaaaaagactatgaaagtggatggttcagg
cttcgggcattaaggtccaacaaggcttaa

DBGET integrated database retrieval system