KEGG   Paenibacillus polymyxa M1: PPM_0830Help
Entry
PPM_0830          CDS       T01968                                 

Gene name
pit
Definition
(GenBank) putative low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ppo  Paenibacillus polymyxa M1
Brite
KEGG Orthology (KO) [BR:ppo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    PPM_0830 (pit)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: CCC83767
Position
989236..990225
Genome map
AA seq 329 aa AA seqDB search
MDTSLLVLGIVIFLALAFDFINGFHDTANAIATSVSTRALTPRRAIIMAAVMNFLGAILF
TGVAKTIGGSVADPTKLTNGIDIVIATLIAAIIWNLLTWWFGIPSSSSHALIGALAGAVY
VGAGQDKLNWSGFIGIVEGLIFSPLIAFVVGYIVMMILKYIFAYRSPHTVNKGFRTMQVI
TAAIQSFTHGTNDAQKAMGIITFALVSAGYQDHLEVPMWVKISAATAMALGTSIGGWKII
KTMGTKIFKIEPINGFAADVSGASVIFTATMLHLPVSTTHAITSAILGVGSAKRFSAVRW
SLAGRIVITWVITIPISALLSGLIFKILF
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggatacaagtttactggtactaggtattgttatttttcttgctctggcatttgatttt
attaatggatttcatgatacggcgaacgcgattgctacttcggtctcgacccgtgcattg
acgccgcgacgtgcgattattatggctgcggttatgaactttctcggagctatcttgttt
accggagttgccaagaccattggtggaagtgtcgctgaccctaccaagcttacaaacggt
attgatatcgttattgcgacgctgatcgctgcgattatctggaatcttctaacctggtgg
tttggtattccttcatcctcctctcatgcattgattggtgcgttggcaggggcggtgtat
gtaggtgcgggacaggataaattaaattggagcggcttcatcgggattgttgaggggctt
attttctccccgttgattgcttttgttgtcggttacattgtgatgatgattttgaaatac
atctttgcttatcgtagtccgcatacagtgaacaaaggtttccgcaccatgcaggtcatt
acggcagctatccagtcgtttacgcatggtacgaatgatgctcagaaggcgatggggatt
atcacattcgcactcgtctccgcaggttatcaagaccatttggaagtacccatgtgggtg
aaaatttcagctgcaaccgctatggcactgggtacgtctattggtggttggaagatcatc
aaaacgatgggaaccaagatttttaaaattgagccaatcaatggattcgcagccgacgtt
tcgggagcttctgttatttttacagctaccatgcttcatttaccagtaagtaccactcat
gccattacttcggcgattctgggtgttggttctgcgaagcgctttagcgcagttcgctgg
tcattagctggtcgtattgtaataacctgggtaataacgattccaatttctgcgctgttg
tcaggtttaattttcaaaattcttttctag

DBGET integrated database retrieval system