KEGG   Paenibacillus polymyxa M1: PPM_1146Help
Entry
PPM_1146          CDS       T01968                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
ppo00071  Fatty acid degradation
ppo00072  Synthesis and degradation of ketone bodies
ppo00280  Valine, leucine and isoleucine degradation
ppo00310  Lysine degradation
ppo00362  Benzoate degradation
ppo00380  Tryptophan metabolism
ppo00620  Pyruvate metabolism
ppo00630  Glyoxylate and dicarboxylate metabolism
ppo00640  Propanoate metabolism
ppo00650  Butanoate metabolism
ppo00900  Terpenoid backbone biosynthesis
ppo01100  Metabolic pathways
ppo01110  Biosynthesis of secondary metabolites
ppo01120  Microbial metabolism in diverse environments
ppo01130  Biosynthesis of antibiotics
ppo01200  Carbon metabolism
ppo01212  Fatty acid metabolism
ppo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PPM_1146 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    PPM_1146 (atoB)
   00640 Propanoate metabolism
    PPM_1146 (atoB)
   00650 Butanoate metabolism
    PPM_1146 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PPM_1146 (atoB)
   00072 Synthesis and degradation of ketone bodies
    PPM_1146 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PPM_1146 (atoB)
   00310 Lysine degradation
    PPM_1146 (atoB)
   00380 Tryptophan metabolism
    PPM_1146 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PPM_1146 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PPM_1146 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PPM_1146 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppo04147]
    PPM_1146 (atoB)
Enzymes [BR:ppo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PPM_1146 (atoB)
Exosome [BR:ppo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PPM_1146 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CCC84083
Position
complement(1397489..1398673)
Genome map
AA seq 394 aa AA seqDB search
MKKVAIVSPLRTAVGSFNKTLAPLSAPELGATVMTACLQQSKLEPSLIDQIFMGNVLQAG
NGQNPARQAALKAGIPIDVPESTINTVCGSGLHAVALAYDSILAEQGNIVLAGGMESMSN
APYLLKNARNGYKLGNGELVDSLVADGLTCPINHYHMGITAENVAEKYGISRLEQDSFAY
ESQIKAFEAKNNKFFEEQIVPVMIKNKKETTYFTEDEHIRGNTTKEKLSNLKPAFKEDGT
VTAGNASGINDGAAAMLVVSEDKCKEHALKPLAYIKGYSLVGVDPAYMGMGPVKAISSLL
KKQGMSIDDIDLFEINEAFAAQALAVQKELGVSPEKVNVNGGAIAIGHPVGASGARVLVT
LVHEMVRRSSRYGVVSLCIGTGMGIAMLVENALI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtagctatagtaagcccgttgagaacagcggtcggttcttttaacaaaacc
cttgcgcctctaagcgctcctgaattgggagcaaccgtgatgacagcatgcctgcagcaa
agtaaattggagccttctttgattgatcaaatttttatgggaaatgttcttcaagcgggc
aatggtcaaaatcctgccagacaggcggcactaaaagcgggtatccccattgatgtaccc
gaatcaacgataaacacggtttgcggttcaggacttcatgccgtcgcgttagcttacgat
tcaatattggcggagcaaggaaacatcgtcttggctggaggcatggagagcatgtcgaac
gccccttatctgctaaaaaatgcaagaaacggctataagcttggcaacggtgaattggta
gactccctggtggctgacggcctaacatgcccaatcaaccattaccatatgggaattact
gccgaaaatgttgccgaaaaatatggaatctcaagactggagcaagattcattcgcctat
gaaagccagataaaggctttcgaagcaaaaaacaacaagttttttgaagagcaaattgtt
ccggtcatgatcaaaaacaaaaaagaaactacttatttcacagaagacgaacacataaga
ggaaatacgacgaaagaaaaactttcaaacttgaagcctgcgtttaaagaggacggaacg
gttactgccggaaatgcttcgggaatcaatgatggtgcggcagctatgttagtcgtgtcg
gaagataaatgtaaggaacatgcgttaaagccgttggcatatatcaagggttattcgctt
gttggtgttgaccctgcatatatgggaatgggaccggtaaaagccatttcgtcactgctg
aagaaacagggaatgtcgattgatgacattgatctctttgaaattaatgaagcgttcgct
gcacaagcactagcggtgcaaaaagagctgggagtcagtccggaaaaggtcaatgtcaat
ggcggcgcgatcgcaatcggtcatcctgttggtgcaagcggtgctagggtattggttacg
ttagttcatgaaatggtgcgcagatcttcacgttacggcgtagtctcgttatgcatcgga
acgggaatgggaatagcaatgctggttgaaaatgcactcatttaa

DBGET integrated database retrieval system