KEGG   Paenibacillus polymyxa M1: PPM_2838Help
Entry
PPM_2838          CDS       T01968                                 

Gene name
rluD1
Definition
(GenBank) ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
ppo  Paenibacillus polymyxa M1
Brite
KEGG Orthology (KO) [BR:ppo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ppo03009]
    PPM_2838 (rluD1)
Enzymes [BR:ppo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     PPM_2838 (rluD1)
Ribosome biogenesis [BR:ppo03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    PPM_2838 (rluD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: CCC85775
Position
3300249..3301034
Genome map
AA seq 261 aa AA seqDB search
MWYSRTLGGLIPLMNQDELTRQEHAQPNIPVLYEDNHVLAVVKPVNVPTQEDASGDPDLL
SLLKEDLKIRHNKPGNVFLGLVHRLDRPVGGAMIFAKTSKAASRLSESVRSRHFHKLYTA
VLNGVPAALQGRLTHYLLKDSRTNTVKTVRPGTAGAKEAILEYRVIGQAAGLSLVEIKLH
TGRSHQIRVQMQAIGCPLYGDQKYGGNLSRPGQQLALWSLLAGAPHPVSKEAMSFHSLPP
VQFPWSEWPLSLYEKMITSEN
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
ttgtggtattctcggacgctgggaggcttaattcctcttatgaatcaagatgaacttact
cggcaagagcatgcacagccgaatattcccgtactatatgaggacaaccatgtcctggcg
gttgtaaagcctgtcaatgttccgacacaggaggatgccagcggtgatcccgatctgctg
tctttactcaaggaagatttgaaaatcagacacaataagcctggtaacgtctttttaggt
ttagttcacaggctagatcggcctgtaggcggagccatgatttttgccaagacgtccaaa
gctgcttctcgcctgtcagagtcggttcgaagtcgtcattttcacaagctgtacacagct
gttctgaatggcgttcctgcggctcttcaaggccggctaacccattacctgctaaaggac
agccgtaccaacacggtcaaaacggttcgacccggcacggccggtgccaaggaagccatt
ttggaataccgcgttatcggacaggctgctggactcagtcttgtggaaattaagctacac
accggacgctcgcaccaaattcgcgtacagatgcaggcaatcggctgtcccctctatggg
gaccaaaaatatggcggtaatctgagccgtcctggtcaacagctggccctctggtccttg
ctcgctggagcaccgcatccggtcagcaaggaagcgatgagcttccactcactgcctccc
gtccaatttccttggagtgagtggcccttgtcgctttatgagaagatgattacgtcggag
aattga

DBGET integrated database retrieval system