KEGG   Paenibacillus polymyxa M1: PPM_3164Help
Entry
PPM_3164          CDS       T01968                                 

Gene name
acsA3
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
ppo00010  Glycolysis / Gluconeogenesis
ppo00620  Pyruvate metabolism
ppo00640  Propanoate metabolism
ppo00680  Methane metabolism
ppo01100  Metabolic pathways
ppo01110  Biosynthesis of secondary metabolites
ppo01120  Microbial metabolism in diverse environments
ppo01130  Biosynthesis of antibiotics
ppo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPM_3164 (acsA3)
   00620 Pyruvate metabolism
    PPM_3164 (acsA3)
   00640 Propanoate metabolism
    PPM_3164 (acsA3)
  Energy metabolism
   00680 Methane metabolism
    PPM_3164 (acsA3)
Enzymes [BR:ppo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PPM_3164 (acsA3)
Lipid biosynthesis proteins [BR:ppo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PPM_3164 (acsA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CCC86101
Position
complement(3645656..3647371)
Genome map
AA seq 571 aa AA seqDB search
MKIEELQAVVPTSNMGSYEQAYNNFQWEDVERHFTWYETGKVNMAHEAIDRHVEEGRGEK
AALLYCDANRHETYTFSQLRASSNRFGNVLRKYGIGKGERVFIFMPRSPELVISMLGVLK
VGAVVGPLFEAFMETAIKDRLEDSGAVALVTTPALLSRVKREELPELRHIFVVGDMDERE
QGIIDFETEMLTSSEELEPEWLSREDGLIIHYTSGSTGKPKGVYHVQNAMIQHYYTGKTV
LDLREDDVYWCTADPGWVTGTSYGIFAPWLNGATNVIRGGRFSPEDWYRTIERHEVTIWY
SAPTAFRMLMSAGEQVVSNYDLSSLRHVLSVGEPLNPEVVRWGWQVYTQRIHDTWWMTET
GGQLICNYPELPIKPGSMGKPLPGIQAAILDDRGQVLPPNRMGHLAIRTPWPSMMNRIWN
NPNKFQEYFRFPGWYVSGDSAYMDEDGYFWFQGRIDDVINSSGERIGPFEVESKLLEHPA
VAEAGVIGKPDTVRGEIIKAFVALRDGYTASEALQQDIYRFVKEGLSAHAAPREIEFKEK
LPKTRSGKIMRRVLKAWELNLPTGDLSTIED
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgaagaactccaggctgtagttcccacatccaacatgggctcttatgaacaa
gcttacaacaactttcagtgggaagatgtagaacgtcattttacgtggtatgaaacaggc
aaagtgaatatggcacatgaagcgattgatcgacatgtagaggaaggacggggggagaaa
gcagcacttttgtattgtgatgcaaaccgtcatgaaacctacactttttctcagcttcgt
gccagctcgaacaggttcggaaatgtgctgcgcaaatacggtattggtaaaggggaacgg
gtgtttatattcatgccgcgttcacctgaactggtcattagtatgcttggggttttaaag
gtaggcgctgttgtcggcccactgtttgaggcgtttatggaaacggcgattaaagatcgc
ttggaggatagcggggcggtggcattagtaaccacacctgcgcttctttcacgggtaaaa
cgtgaggagcttcctgagttgcgtcatatttttgtggtcggtgatatggacgaacgggag
cagggaattattgatttcgaaacggaaatgctcacatcctcagaagagcttgagcccgaa
tggctgagtcgtgaagatggattaattattcactatacatcaggctcaacgggcaagccc
aaaggcgtgtatcatgtacaaaatgcaatgattcagcattactatacgggtaaaacggtg
ctggatctgcgggaagatgatgtatattggtgtactgcggatcctggctgggttacggga
acgtcatatggcatttttgctccttggctaaatggagcaacaaatgtcatccgtggaggc
cgtttcagcccagaggactggtaccgtacgattgaacgtcacgaagtgacgatttggtat
agtgctcctacggcgtttcggatgttgatgagcgcaggggagcaggtagtttccaactat
gatctcagcagcttgcggcatgtattatccgttggggagccactgaatcccgaggtagtg
agatggggctggcaagtatacacacagcgtattcatgatacttggtggatgacggaaaca
ggaggccagttgatctgtaattacccagagctgccgattaaaccaggttcgatgggaaag
ccacttccaggtattcaagctgctattttggacgacagaggccaggtgttgcctcctaat
aggatgggacatttggcgattcgtacaccatggccatccatgatgaaccgtatatggaac
aacccaaataagtttcaggaatatttccgctttcccggttggtatgtatccggtgattca
gcttacatggatgaggacggatacttctggtttcagggaagaattgatgatgttatcaac
tcctccggagagcgcatcggtccttttgaggtggagagcaagcttctggagcatcctgct
gtagcggaagctggagtcattgggaaaccagatactgttcgaggagagatcattaaagca
tttgtcgccctgcgtgatggctataccgcgtcggaagcgttacaacaggacatttaccgc
ttcgtcaaggaagggctgtctgctcatgctgctccgcgtgaaattgaatttaaggaaaag
ttacccaaaacccgttccggcaaaattatgagacgtgtgctgaaagcctgggagcttaac
cttcctacaggtgacctgtctaccattgaggattga

DBGET integrated database retrieval system