KEGG   Paenibacillus polymyxa M1: PPM_3760Help
Entry
PPM_3760          CDS       T01968                                 

Gene name
gldA5
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
ppo00561  Glycerolipid metabolism
ppo00640  Propanoate metabolism
ppo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    PPM_3760 (gldA5)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    PPM_3760 (gldA5)
Enzymes [BR:ppo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     PPM_3760 (gldA5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: CCI70569
Position
complement(4338210..4339343)
Genome map
AA seq 377 aa AA seqDB search
MRKAFISPSKYVQGENELLNLGYYVSTFGKSALLIAHPADVERVKDKLDSTTEKYNVTFI
ESGFMGECSRQEVSRLQEIATANRCDCIVGLGGGKAIDAAKCVAQGEALIICPTIAATDA
PTSHSAVLYTPEGAFDDYAYFKQSPSVVLVDTTVIANAPTRFLVSGMGDALSTYFEARAT
SRSYSRVNAGLPNGVREGQCAPAVGTNAALALATLCYEMLLKDGAKAKAACDENQVTQAL
ENIIETNILLSGLGFESGGLAAAHAIHDGLTILEGTHHYYHGEKVAFGTIAQLVLENAPT
EELHQVLDFCLTIGLPVCLADIGVDHISREELMEVAAKACIEEESIHAMPFPITVEQVAA
AIAAADRIGSQYKAEVK
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagcttttatcagcccaagcaaatatgtacaaggtgaaaacgaattgttgaat
ttgggttactatgtgagcaccttcggcaaatctgccttactgatcgcgcatccagccgat
gtggagcgggtgaaagataagcttgattccactacggaaaaatataacgtgacctttatt
gaaagcggttttatgggtgagtgctccagacaggaagtgtctagactccaagaaatcgcc
actgcgaatagatgtgattgcatcgttggtctcggcggcggcaaagcgattgacgcggca
aaatgtgtggcacaaggggaagcgcttatcatctgtccgacgattgctgcgacggatgcg
ccgacaagtcactcggccgttctttatactccagaaggcgccttcgacgattacgcctat
tttaaacaaagcccgagtgtcgtattagtcgacaccactgtaattgccaatgcaccaacc
cgattcctcgtatcaggtatgggtgatgcactgtcgacatactttgaagcccgtgcgacc
tcccgctcttactccagggtcaacgctggactgcctaacggagtacgcgagggacagtgt
gcgccagccgtaggtacgaatgcggcgttggcacttgcaacgttatgctatgaaatgctc
ttaaaagacggtgccaaagcaaaagcggcatgcgatgaaaatcaagttacacaagcactc
gaaaatatcattgaaactaatattttactctcaggtcttggcttcgaaagcggcggactt
gctgcggcccatgcgattcatgatggactcaccattttggaaggcacgcatcattattat
catggagaaaaagtcgcattcggtacgatcgcacagctggtgctcgaaaacgcaccgacg
gaagaattacatcaggtactggatttctgtttaaccatcggtttgccggtctgcttggcc
gatatcggtgtcgatcatatcagccgggaagaactcatggaagtagctgctaaagcctgc
attgaggaggaatcgattcatgccatgccgtttccgatcacggtggagcaggttgcagcg
gcaattgctgcggccgaccggatcggcagccagtacaaagcggaggtaaaatag

DBGET integrated database retrieval system