KEGG   Pectobacterium polaris: BJK05_15075Help
Entry
BJK05_15075       CDS       T05195                                 

Gene name
putA
Definition
(GenBank) trifunctional transcriptional regulator/proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
ppoa  Pectobacterium polaris
Pathway
ppoa00250  Alanine, aspartate and glutamate metabolism
ppoa00330  Arginine and proline metabolism
ppoa01100  Metabolic pathways
ppoa01110  Biosynthesis of secondary metabolites
ppoa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppoa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BJK05_15075 (putA)
   00330 Arginine and proline metabolism
    BJK05_15075 (putA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ppoa03000]
    BJK05_15075 (putA)
Enzymes [BR:ppoa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     BJK05_15075 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     BJK05_15075 (putA)
Transcription factors [BR:ppoa03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    BJK05_15075 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH RHH_1
Motif
Other DBs
NCBI-ProteinID: ASY81237
Position
complement(3428963..3432931)
Genome map
AA seq 1322 aa AA seqDB search
MGSTTMGVKLDEETRERIKTAAQRIDRTPHWLIKQAIFHYLECLENGLDTPETPQWANVS
HIEAEEIMPQSREEETHPPFLDFAEQILPQSVIRAAITSVYRRPESELVPILLEQARLTD
EMSQLTQKLAYQLAEKLRCQKAGNGRAGIVQGLLQEFSLSSQEGVALMCLAEALLRIPDK
STRDALIRDKISRGNWQAHLGQSPSLFVNAATWGLLFTGKLVATHNEVNLSNSLNRIIGK
SGEPLVRKGVDMAMRLMGEQFVTGETIGEALANARERESKGFRYSYDMLGEAALTEHDAA
AYLTAYQQAIHAIGKASNGRGIYEGPGISIKLSALHPRYSRSQYDRVMEELYPRLLMLTL
LARQYDIGINIDAEEADRLEISLDLLEKLCMDPQLAGWNGVGFVIQAYQKRCPYVIDALI
ELAQRSRRRLMIRLVKGAYWDSEIKRAQVDGLEGYPVYTRKVYTDVSYLACARKLLAVPN
LIYPQFATHNAQTVSSIYHMAGNNYYPGQYEFQCLHGMGEPLYDQVVGAAADGKLNRPCR
IYAPVGTHETLLAYLVRRLLENGANTSFVNRIADTSMALETLIADPIRGVEALAKVEWIM
GAPHPKIPLPRQLYGQERQNSSGLDLSNEHRLASLSSALLNHASQPWYAAPMIEGESEAS
EERPVVNPADVHDVVGYVLDASVADVELAVDAAVHAGTIWFATPPAERAAILNQAASLME
GQLQSLLGLLVREAGKSFSNAIAEVREAVDFLRYYAAQIRDTFTNDTHRPLGPVVCISPW
NFPLAIFTGQISAALAAGNSVLAKPAEQTPLIAAQAVRILHEAGIPQSVLQLLPGQGETI
GAALVNDERVRGVVFTGSTAVAKTLQRSIAGRLDPQGRLTPLIAETGGLNAMIVDSSALT
EQVVNDVIASAFDSAGQRCSALRLLCLQEDIADRTLAMLRGAMAACRMGNPERLSTDIGP
LIDAEAKESVERHIQTMRAKGHTVFQAAYPQDEETWRHGTFVKPTLIELGKIDELKKEVF
GPVLHVVRYQSQQLDTVIEQINAAGYGLTLGVHTRIDETILRVTGKAKVGNQYVNRNMVG
AVVGVQPFGGEGLSGTGPKAGGPLYLYRLLTHRPDDALAAEFAQQSREQALDASARSSLL
AGLQALEDWAIAGARDGLAMLCQRYREYSVSGTTRLLPGPTGESNSYTLLPRERILCLAD
NEDDRLIQTAAVLAAGGKLLWPEGEHEKRLYGRLPAGVQSHIQFTPDWQRQDVSFHGVIY
HGDADRLRQLSEALAERDGPIIQPLGYAQGDTHVQLERLLTERSLSINTAAAGGNASLMT
IG
NT seq 3969 nt NT seq  +upstreamnt  +downstreamnt
atgggttctaccacgatgggtgtaaaactcgatgaggaaacgcgcgaacgtatcaagacg
gcagcacagcgtattgatcgtacaccgcactggctgatcaaacaggctattttccattac
ctcgaatgcctcgaaaatggcctcgatacgcctgaaacaccgcaatgggcgaacgtcagc
cacattgaagcggaagagattatgccgcaatctcgggaagaagaaacccacccacccttt
cttgatttcgccgaacagattcttccgcagtcagttattcgcgccgccattacttctgtt
taccgccgccccgaaagtgaactggtgcctatcttgctcgaacaggcaagacttaccgat
gaaatgtcgcagttaacgcagaagctggcttatcaactggcagagaaattacgctgtcag
aaagccggaaatgggcgtgcgggcattgtgcaagggctgctacaggaattctcactttct
tctcaggaaggggtggcgctgatgtgtttagccgaagcgctgctgcgcatccctgataaa
tccacgcgcgatgcgctgatccgcgacaagatcagtcggggaaactggcaggcacatctt
ggccaaagcccgtcactctttgtgaatgctgcaacctgggggctgctgtttaccgggaag
ctggtggcgacgcacaacgaagtgaacctctcgaattcgctgaaccgcatcatcgggaaa
agcggtgagccgctggtccgcaaaggtgtcgatatggctatgcggctgatgggggagcag
tttgtcactggagaaaccattggtgaagcgctggcgaatgcccgcgaacgggagagtaaa
ggcttccgttattcttacgatatgttaggcgaagctgcgctgacggaacacgatgctgcc
gcgtatctgacggcctatcagcaggcgattcatgctattggcaaagcctcgaacgggcgc
gggatttatgaagggccgggcatctccatcaagctgtcggcgctgcatccccgctatagc
cggtcgcagtatgaccgggtgatggaagaactttatccgcgtttgttgatgctgacgctg
ctggcgcgtcagtacgatatcgggatcaatattgacgcggaggaagccgatcgactggag
atctcactcgatctgctggaaaaactctgcatggatccgcagttggcggggtggaatggc
gttgggtttgtcattcaggcttatcagaaacgctgcccgtatgtgattgatgcgctgatt
gagctggcacagcgcagccgtcggcggctgatgattcgtctggtgaaaggggcgtactgg
gacagtgaaatcaagcgtgcgcaggttgacgggctggaaggctatccggtctacacgcgt
aaggtttataccgatgtgtcgtatctggcatgcgcccgcaaactgttggccgtaccgaat
ctgatttacccgcagtttgccacgcacaacgcgcagacggtaagctcgatctaccacatg
gcgggcaacaattattatcccggtcagtatgagtttcagtgcctgcacggcatgggcgaa
ccgctctacgatcaggtggtgggtgcggcggctgacggcaagctgaaccgtccgtgtcgt
atttatgctccggtcggaacccatgaaacgctgctggcttatctggtgcgacgcctgttg
gaaaacggcgcgaatacctcgtttgttaaccgcattgcggatacctcgatggcgctggaa
acgctgattgccgatccgattcgtggcgtagaggcgctggcaaaagtggaatggatcatg
ggcgcaccgcatcccaagattcctctgccgcgtcagctatatgggcaggaacggcaaaac
tcgagcggactggatctctcgaacgagcaccggctggcttcgctctccagcgcgttgctg
aatcatgcatcacagccgtggtatgccgcgccaatgattgagggggaaagcgaggcgagt
gaagaaagacctgtcgtgaatcccgcagatgtgcacgatgtggtgggctacgttctcgat
gcctcggtggcggatgttgagctggcggtagacgcggcggtacatgctggcaccatttgg
tttgcgacgccgcccgcagagcgggccgcgatattgaatcaggccgcctcgctgatggaa
gggcagttgcaaagtctgctggggctgctggtgcgggaagcgggtaaatccttcagtaac
gcgattgctgaagtgcgcgaagcggtggatttcttacgctattacgcggctcagattcgg
gacacgttcactaacgatactcatcgtccactggggccagtggtttgcatcagcccgtgg
aatttcccgctggcgatcttcaccggtcaaatttctgccgcactggcggcaggcaacagc
gtgctggcgaaaccggctgaacagacgccgctgatcgcggcacaggcagtgcgtatttta
catgaggcgggcattcctcagagtgtgctgcaattgctgcccggacagggagaaacgatt
ggtgcggcgttggtgaacgatgaacgggtacgcggcgtggtgtttactgggtcgacggcc
gttgccaaaaccctgcaacgcagcatcgcgggcaggctcgatccacaggggcgtttgacg
ccgctgattgccgaaacgggcggcctgaatgcgatgattgtcgattcgtctgcgctgacg
gagcaggtggtgaatgacgttattgcctccgcgttcgacagcgccggacagcgttgctcg
gcgctgcgcctgctgtgtctgcaagaggatatcgcggatcgcactctggctatgctgcgt
ggcgcgatggcggcgtgtcgaatggggaatcctgaacggttatcgaccgacatcggtccg
ctgattgacgctgaagcgaaagagagcgtggaacggcatattcagacaatgcgggcgaaa
ggccataccgtatttcaggctgcgtatccgcaggatgaggagacgtggcggcacgggacg
tttgtgaaaccgactctgatcgaactgggcaaaatagacgagctgaaaaaagaagttttt
ggtccagttttacacgtagttcgctatcaaagccagcagttggataccgtaattgagcag
atcaacgcggcgggatacggcctgacgctgggtgtgcatacccgcattgatgaaactatt
ctgcgcgtgacgggcaaggcgaaggtgggtaatcagtatgtgaaccgcaatatggtcggt
gccgttgtcggtgttcaaccgtttggcggggaaggcttatcaggaaccggaccaaaggcg
ggcgggccgctttatctgtaccgcttgctgacacatcggcctgacgacgcgcttgcggca
gaattcgcacagcagagccgtgagcaagcgctggatgcgtctgcccgatcgtctctgctg
gcggggctacaggcgctggaagactgggcgatcgctggggcacgtgacgggctagcgatg
ttatgccagcgctatagagaatatagcgttagcgggacaacgcgactgctgcccggcccg
acaggagaaagtaattcctacacgctgctgccgcgtgaacggattctgtgtctggcagat
aatgaggatgatcgcttgattcagacggcggcggtgctggcggcgggcgggaaactgctg
tggccggaaggtgagcacgagaaaaggctctatggccgtttacccgcaggagtgcagtcg
catattcagttcacgcccgattggcaacggcaagacgtgtcttttcatggcgttatttat
catggggatgccgatcggttacggcaactgagtgaagcgcttgcagagcgcgatggcccg
attatccagccgttaggctatgcgcagggtgatacccacgttcagttggagcgtctgttg
accgaacgttccctgagtatcaataccgctgccgcgggcggcaatgccagcctgatgacg
ataggctaa

DBGET integrated database retrieval system