KEGG   Pectobacterium polaris: BJK05_20540Help
Entry
BJK05_20540       CDS       T05195                                 

Definition
(GenBank) hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
ppoa  Pectobacterium polaris
Brite
KEGG Orthology (KO) [BR:ppoa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BJK05_20540
Enzymes [BR:ppoa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     BJK05_20540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ASY82237
Position
complement(4682800..4683597)
Genome map
AA seq 265 aa AA seqDB search
MKVALGQFAVDREWQQNATTITEFMLSAQKNGADLLVLPEGVLARDITNPNMVLTAAQPL
DGPFISHLLEASKGSDLTTMLCVHIPNGEGKVWNTLLALRNGELVAQYRKLHLYDAFSVQ
ESENVLAGEEVPPLLTIAGLNVGLMTCYDIRFPELARRLVLDGADVLVLPSAWIKGPLKE
AHWELLVRARALENTTYLVAVGECGVKNIGNSMVVDPLGVVVVQAPETPALIYADIDPER
LAYARQILPVLANRRFSTPTLEEEN
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgcactgggacagtttgccgttgaccgcgagtggcagcaaaacgccacgacc
atcactgagtttatgttgtcagcacagaaaaacggtgccgacctgctggtgctgcccgaa
ggcgtgctggctcgcgatatcaccaatcccaacatggtgctcaccgctgctcaaccgctt
gatggcccgtttatctcgcatctgctggaggccagcaaaggcagcgacctgacgaccatg
ctgtgtgtacatatcccgaatggtgaagggaaagtctggaacacgctgctggcgctgcgc
aacggcgagctcgttgctcaataccggaagctgcatctgtacgatgcgttttccgtacaa
gaatcggaaaacgtactggcaggcgaagaggttccgccgctgttaaccatcgccgggttg
aacgtcgggctgatgacctgctatgacatccgcttccctgagcttgcacgccgtttggtg
ctggacggcgctgacgtgctcgttctcccttctgcctggattaaggggccgctgaaagaa
gcgcattgggaattattggtgcgcgccagggcactggaaaacaccacttatctcgtcgcc
gttggcgagtgcggcgtcaagaatatcggcaacagcatggtggtcgatcctttaggcgtt
gtcgtggttcaggcaccggaaacaccggctcttatctatgccgacattgacccagaacga
ctggcgtatgcccgtcagattctcccggtactggctaatcgccgctttagcacacccacg
ttggaagaggaaaactga

DBGET integrated database retrieval system