KEGG   Paenibacillus polymyxa CR1: X809_03615Help
Entry
X809_03615        CDS       T02956                                 

Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
ppol  Paenibacillus polymyxa CR1
Pathway
ppol00860  Porphyrin and chlorophyll metabolism
ppol01100  Metabolic pathways
ppol01110  Biosynthesis of secondary metabolites
ppol01120  Microbial metabolism in diverse environments
Module
ppol_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ppol00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    X809_03615
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ppol01007]
    X809_03615
Enzymes [BR:ppol01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     X809_03615
Amino acid related enzymes [BR:ppol01007]
 Aminotransferase (transaminase)
  Class III
   X809_03615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AHC18397
Position
complement(781692..783011)
Genome map
AA seq 439 aa AA seqDB search
MMKRENSEALYKEALEHIVGGVNSPSRSFKAVGGGAPVFMKRAKGAHFWDEDDNRYIDYL
AAYGPIITGHAHPHITKAISEAAANGVLYGTSTVLEIKLAKMLKEAIPSMDKVRFVNSGT
EAVMTTIRVARAYTKRNKIIKFAGCYHGHSDLVLVAAGSGPSTLGIPDSAGITTNIASEV
ITVPFNDLDALRQALERWSDDVAAVMVEPIVGNFGMVMPQPGYLEGLCSMARANGSLVIY
DEVITAFRFHFGSTQTYAGLDNHDAIQPDLTALGKIMGGGLPIGAYGGSKHIMEQVAPLG
PAYQAGTMAGNPASISSGIACLEVLQGEGVYEEMERLAVRLTDGIQSSAERYGVPLTINR
IRGAFSTHFCDHPITNYAQAQDTDSEAFASFFRHMLDRGIHLAPSKYEAWFLTTAHTDED
VDTTLEAADDSFRAMSQGK
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaacgggaaaactccgaagcactatataaagaagccctggagcatattgtcggg
ggcgttaacagcccttcacgctcctttaaagctgtgggcggcggcgctccagtattcatg
aaacgcgctaaaggtgctcatttctgggatgaggatgataatcggtatatcgactatttg
gcggcttatggccctattattactggacatgcccatccccatattactaaggctatcagc
gaagcggccgcgaacggcgtattgtacggaacctcaacggtattggaaatcaaactggcc
aagatgctgaaggaagcaattccttctatggacaaggtccggtttgtgaattctggcaca
gaagcggttatgacaacgattcgtgttgcacgggcctatacgaaacggaacaagatcatc
aaatttgccggctgctaccacggtcactcggatctggtacttgttgccgcaggctccggc
ccttccacgctaggcatacctgacagtgcaggcattacgaccaacattgcgagcgaggtt
attaccgtaccattcaatgatctcgacgcgttacgccaagccttggagcgttggagcgac
gatgtggcggcagtcatggtcgagcccattgtcggtaattttggcatggtcatgccgcaa
cccggttatttggaagggttgtgctccatggcgcgtgcgaacggctcactcgtcatttat
gacgaggtcattaccgcattccgattccacttcggttccacccaaacgtatgcaggtttg
gacaaccatgatgcgattcagccagatttgaccgcgctgggcaaaatcatgggcggtggt
ctgccgattggtgcctacggcggcagcaagcacatcatggagcaggttgccccactcggc
ccagcttatcaggcgggtacgatggcgggcaacccggcgtccatctcgtcaggcatcgcc
tgccttgaagtccttcaaggggaaggcgtgtatgaagagatggaacgtctggctgtgagg
ctgacggacggtatccagtcctctgccgaacgctacggcgtgccattgacgatcaaccga
attcgtggagcgttctcgacgcatttctgtgatcatccgatcacgaattacgcgcaggcg
caggatacggatagcgaagcgtttgcatccttcttccgtcacatgctggatcgcggtatt
catctggcaccatccaagtacgaagcctggtttctcacaacagcgcatacggatgaagac
gtggatactacgctggaagcggcggacgattcgttccgggcgatgtcacaaggtaagtaa

DBGET integrated database retrieval system