KEGG   Paenibacillus polymyxa CR1: X809_06085Help
Entry
X809_06085        CDS       T02956                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppol  Paenibacillus polymyxa CR1
Pathway
ppol00071  Fatty acid degradation
ppol00072  Synthesis and degradation of ketone bodies
ppol00280  Valine, leucine and isoleucine degradation
ppol00310  Lysine degradation
ppol00362  Benzoate degradation
ppol00380  Tryptophan metabolism
ppol00620  Pyruvate metabolism
ppol00630  Glyoxylate and dicarboxylate metabolism
ppol00640  Propanoate metabolism
ppol00650  Butanoate metabolism
ppol00900  Terpenoid backbone biosynthesis
ppol01100  Metabolic pathways
ppol01110  Biosynthesis of secondary metabolites
ppol01120  Microbial metabolism in diverse environments
ppol01130  Biosynthesis of antibiotics
ppol01200  Carbon metabolism
ppol01212  Fatty acid metabolism
ppol02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    X809_06085
   00630 Glyoxylate and dicarboxylate metabolism
    X809_06085
   00640 Propanoate metabolism
    X809_06085
   00650 Butanoate metabolism
    X809_06085
  09103 Lipid metabolism
   00071 Fatty acid degradation
    X809_06085
   00072 Synthesis and degradation of ketone bodies
    X809_06085
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    X809_06085
   00310 Lysine degradation
    X809_06085
   00380 Tryptophan metabolism
    X809_06085
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    X809_06085
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    X809_06085
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    X809_06085
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppol04147]
    X809_06085
Enzymes [BR:ppol01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     X809_06085
Exosome [BR:ppol04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   X809_06085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AHC18846
Position
complement(1364022..1365206)
Genome map
AA seq 394 aa AA seqDB search
MKKVALVSPLRTAVGSFNKTLAPLSAPELGATVMTACLQQSRLEPSLIDQIYLGNVLQAG
NGQNPARQAALKAGIPIDVPETTINTVCGSGLHAVALAYNSILAEQGNIVLAGGMESMSN
APYLLRNARNGYKLGNGELVDSLVADGLTCPINHYHMGITAENVAEKYGISRLEQDEFSY
QSQIKAVEAKNKKLFEEQIVPVMIKNKKETISFTEDEHIRGNTTKEKLSQLKPAFKENGT
VTAGNASGINDGAAAMLVVSEDKCKEHELKPLAYIKGYSLVGVDPAYMGMGPVKAISSLL
KQQGMSIDDIDLFEINEAFAAQALAVLKELGINPEKVNVNGGAIAIGHPVGASGARVLVT
LVHEMVRRSSRYGIASLCIGTGMGIAMLVENALI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtagctttagtaagcccgttgagaacagcggtcggctcttttaacaaaacc
cttgcgcctctaagcgctcctgaactgggagcaactgtgatgacagcatgccttcagcaa
agtagattagagccttctttgatcgatcaaatttatttgggaaatgttcttcaggcgggc
aatggccaaaatcctgccagacaggcggcactaaaagccggtatccctattgatgtaccc
gaaacaacgataaacacggtttgcggttcaggactccatgccgttgctttagcctacaat
tcaatattggcggaacaaggcaacatcgtcttggccggaggcatggagagcatgtcgaat
gccccttacctgctaaggaatgcaagaaacggctacaaacttggcaacggtgagttggta
gactccctggtggccgacggtcttacgtgcccgatcaaccattaccatatgggaattacc
gcagaaaatgttgcagagaaatatggaatttcaagacttgagcaggatgaattttcctat
caaagccagataaaggccgtagaagctaaaaacaagaagctttttgaagagcagattgtt
ccagtcatgatcaaaaacaaaaaagaaactatttctttcacggaggacgaacacataaga
ggaaatacaacgaaagaaaaactttctcaattaaaacctgcgtttaaggagaacggaaca
gttaccgccggaaatgcttcaggaatcaatgatggcgcggcggctatgcttgtagtgtcg
gaagacaaatgtaaggaacatgagttaaagccgttggcatatatcaagggttattcactt
gttggcgttgaccctgcatatatgggaatgggaccggtgaaggccatttcgtcacttctg
aagcaacagggaatgtctattgatgacatcgatctttttgaaattaatgaagcgttcgcc
gcacaagcactagcggtattgaaagagcttggaatcaatcctgagaaggtgaatgtcaat
ggcggcgcgatcgcgatcgggcatcctgtcggtgcaagcggtgctagggtattggttacg
ctggttcatgaaatggtgcggagatcttcacgttacggcatcgcctcgttatgcatcgga
acgggaatgggaatagcgatgctagttgaaaatgcactcatttaa

DBGET integrated database retrieval system