KEGG   Paenibacillus polymyxa CR1: X809_38895Help
Entry
X809_38895        CDS       T02956                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ppol  Paenibacillus polymyxa CR1
Pathway
ppol03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ppol00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    X809_38895
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ppol03011]
    X809_38895
Ribosome [BR:ppol03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    X809_38895
  Bacteria
    X809_38895
  Archaea
    X809_38895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AIW41840
Position
complement(5257470..5257802)
Genome map
AA seq 110 aa AA seqDB search
MEAKAHAKSVRISARKVKLVIDLIRGKQVGEAIAILRHTPKSASPVVEKLLNSAIANADH
NYSLDVNKLVVSQVFVNQGPTMKRFRPRAMGRASRINKRTSHITLVVSEK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaaaagcacatgctaagtccgtacggatttctgctcgcaaagtgaaacttgtt
atcgatttgattcgcggtaagcaggttggtgaggcgatcgcaattcttcgtcacactcca
aagtccgcttctccagtcgttgagaaattgttgaattctgcgattgcaaatgcagatcac
aactactctttggacgtaaataaattggtagtatctcaggtttttgtaaaccaaggtcct
acaatgaaacgattccgcccgcgtgcaatgggtcgtgcaagtcgcatcaacaaacgcacc
agtcatattactctggtggtatctgaaaaataa

DBGET integrated database retrieval system