KEGG   Paenibacillus polymyxa CR1: X809_40370Help
Entry
X809_40370        CDS       T02956                                 

Definition
(GenBank) beta-glucosidase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
ppol  Paenibacillus polymyxa CR1
Pathway
ppol00460  Cyanoamino acid metabolism
ppol00500  Starch and sucrose metabolism
ppol01100  Metabolic pathways
ppol01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    X809_40370
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    X809_40370
Enzymes [BR:ppol01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     X809_40370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3_C Glyco_hydro_3 Fn3-like CBM_6 DUF5010_C
Motif
Other DBs
NCBI-ProteinID: AIW42108
Position
complement(5614353..5617295)
Genome map
AA seq 980 aa AA seqDB search
MSHETTGIEYLFQDPKIHLDERVRDLVSRLTLEEKVESMLQYQPAIDRLGVAAYKHGTEA
AHGIAWLGEATSFPQPVGLACTWDTELMRLIGSVIADEARVYYRRDPKLNGLTLWAPTVD
MERDPRWGRNEEAYGEDPYLTGELSKELVKGIQGDHPVYLKAVATLKHFLGNNNEVDRGI
GSSSIDPRNLREYYLRAFEKPFTEGGAQSMMTSYNLINGTPATLYHGVNDIVRGEWGMDG
FVVSDAGDVMGIVNDHQYYDSHTPGVAESIRAGIDSITDDAELSKQAIREALAQGTLQEE
DLDRALFHTFRVRFRLGEFDPAADNPYASIGEEALLTEQARELSLRAAREQIVLLKNEHE
LLPLNPARCGKVAVIGTHGNEVYRDWYSGTLPYRVTPLEAIRAKLEGEDAKERVVYRDGK
KRVILTAVNDGAKLTVDSSGEMRLSQDGEPTVLTMTDWGYGSVTLHDEHLGTYVTSDEET
LRVTADEAYGWYVKEVFGLTPVGQGEHLWTTWNGKPVIARTEGSLKVVEAEKSALNAVES
NASTVLGQSHTFQVETVSDGLAEAIAAAQAADTAIVFVGNHPLINGKEENDRPGLELAAS
QQRLIEEVYRVNPNTIVVLTGSYPFAIPWVQEHIPAIVYTSHAGQEHGTAIADVLFGDYA
PAGRLNMTWVQSEDQLGDIKDYDIIRGGRTYQYFEGESLYPFGHGLTYSPFEYNDLRTDA
PKDSVKSIAALDAVDTLQVWVEVTNRGVAAGEEVVQLYVRPGASRVKRPLKTLCGFQRIR
LDAGETRTVSFTIRMKDWAIWDVTRDCYCVETGEYTLLAGASSADIRLEHPVYVRGEVIP
PRQAGRSIRAENFDNCSDIVLDESKEQREACVRPRTPQRSGWIAFHGVDMDTVSVVELQC
RVSGNSSDATIELRLDAPDSEAVARVNVGNTGGAQAWVTLSEAVHSVSGTRDVYLLLSGE
VRLAHFTLGANATEDSGFQA
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatgaaacaacgggtatcgaatatttatttcaagatccgaagattcatctggat
gagcgtgtacgggatctcgtttcgcgactaaccttggaggaaaaggttgaatccatgttg
caataccagccggccattgaccgattgggagtcgcagcttataagcacggtacggaagcg
gcacacgggatagcgtggttaggtgaggcgacttcatttcctcagcctgtaggattggca
tgtacttgggatacggaattaatgcgcctcatcggctctgttatcgcagatgaggcacgt
gtttactatcgacgtgatccaaaattaaacggtctgaccctgtgggcacctacggtggat
atggagcgtgacccgagatggggacgcaatgaggaagcttacggcgaagatccgtatttg
acgggagagttgtcaaaggagttagtcaaggggatacagggggatcatccggtatatttg
aaagcggttgccactttaaaacattttctgggtaacaacaatgaagtggaccggggaatc
ggctcctccagtatagacccacgaaatctgcgagaatattacttaagagcctttgagaag
ccttttacagaaggcggagcccagtcgatgatgacttcttacaacctgattaatggaacg
cctgctacgttatatcatggggttaacgatattgtcaggggcgaatgggggatggacggc
tttgttgtaagtgatgcgggtgatgtcatggggattgtcaacgatcatcagtattacgat
tcccatacgcctggcgtggccgaatctattcgggcgggaattgacagcattacagatgat
gcagagctctccaaacaggcaattcgtgaagccttggcgcaaggaacgctacaagaagaa
gacctggatcgggcattgttccatacgttccgtgtccgttttcgtttgggggaatttgat
ccggcggcagacaatccttatgcctcaatcggagaggaagctctcctgacagagcaagcc
cgtgaattgtcgctgcgtgcggcgagggagcagatcgtactgcttaaaaatgagcatgaa
ctcttgccattgaaccctgcccggtgtggcaaagtagcggtcattggtacgcatggcaat
gaggtgtaccgcgactggtattccggtacgctgccctaccgggttacaccgctggaggcg
attcgtgccaagctggaaggcgaggacgcaaaggaacgcgtcgtgtaccgtgacggtaag
aaacgcgtgatcttgacggcggtgaatgacggagcgaagctcacagtcgattcttccggt
gagatgcgcctgtcccaggatggagagcccacagtattgaccatgacggattggggctat
ggcagtgtgacgttacatgatgagcatctgggtacttacgtgacgagtgatgaggaaacg
ctccgtgttacagctgatgaagcgtatggctggtatgtcaaagaggtctttgggctgact
cctgttggacaaggagagcatctgtggacaacatggaatggcaaaccagtgattgccaga
acggagggctcattaaaggtagtggaggctgaaaaatctgcacttaacgctgtagagagt
aacgcctcgacagttttaggacagagccacacattccaggtagagacggtgtcagatggt
ttagcggaagcgatagccgctgcgcaagcggcagatacagcaattgtatttgttggaaat
cacccgctcatcaatggaaaggaagagaatgaccgtccaggcttggaactggcagcttcc
cagcaacggcttatcgaggaagtgtatcgcgtcaatccgaatacgattgtggttctgacg
ggcagctatccatttgccatcccttgggttcaggagcatattccagcgatcgtatacacg
tctcatgcgggacaagagcatggtacagcaatagcggatgtgttatttggagattacgcg
ccagcggggcgtttgaacatgacctgggttcagagcgaggatcaattgggcgacatcaaa
gattacgatattattcgcggcggtcgtacctatcaatattttgaaggtgaatccttgtat
ccgtttggccatggattgacgtattcgccttttgaatataatgacctgcgtacggatgcc
ccaaaggatagcgtaaaatctattgctgcactggatgccgtggatacgctccaggtgtgg
gtagaggtgacgaatcggggtgtagctgctggtgaagaggttgtacaactctatgtacgg
cccggtgcctcacgagtaaagcgaccactgaagacattgtgcggttttcaacgtattcgc
ttagacgcaggtgagacgcgaacggtttcctttacgattcggatgaaggattgggcgatt
tgggatgttacacgggattgctattgcgttgaaacgggggaatatacactgctggcaggc
gcttcctcagcggatattcggttggagcaccctgtgtacgttcgtggcgaagttattcca
ccacgccaagccggacgaagtattcgcgctgaaaactttgataattgctccgacatcgta
ctggatgaaagcaaggagcaaagggaggcctgtgtacgtccgcgcacacctcaacgttcc
ggttggattgcctttcatggcgtagacatggatacggtgagtgtggtcgagcttcagtgt
cgcgtgtcaggcaacagtagcgatgccacaattgagctgcgtttggatgcaccggacagc
gaagctgtggcacgtgtgaacgtgggcaatacaggaggggcgcaagcatgggttacgctt
tcggaagcggtacattcagtctctggcacacgtgatgtatacctgttgttgagcggggaa
gtgcggctagctcattttactttgggcgctaatgctacagaggattccggctttcaggct
tga

DBGET integrated database retrieval system