KEGG   Paenibacillus polymyxa Sb3-1: RE92_05825Help
Entry
RE92_05825        CDS       T03812                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppoy  Paenibacillus polymyxa Sb3-1
Pathway
ppoy00071  Fatty acid degradation
ppoy00072  Synthesis and degradation of ketone bodies
ppoy00280  Valine, leucine and isoleucine degradation
ppoy00310  Lysine degradation
ppoy00362  Benzoate degradation
ppoy00380  Tryptophan metabolism
ppoy00620  Pyruvate metabolism
ppoy00630  Glyoxylate and dicarboxylate metabolism
ppoy00640  Propanoate metabolism
ppoy00650  Butanoate metabolism
ppoy00900  Terpenoid backbone biosynthesis
ppoy01100  Metabolic pathways
ppoy01110  Biosynthesis of secondary metabolites
ppoy01120  Microbial metabolism in diverse environments
ppoy01130  Biosynthesis of antibiotics
ppoy01200  Carbon metabolism
ppoy01212  Fatty acid metabolism
ppoy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppoy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RE92_05825
   00630 Glyoxylate and dicarboxylate metabolism
    RE92_05825
   00640 Propanoate metabolism
    RE92_05825
   00650 Butanoate metabolism
    RE92_05825
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RE92_05825
   00072 Synthesis and degradation of ketone bodies
    RE92_05825
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RE92_05825
   00310 Lysine degradation
    RE92_05825
   00380 Tryptophan metabolism
    RE92_05825
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RE92_05825
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RE92_05825
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RE92_05825
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppoy04147]
    RE92_05825
Enzymes [BR:ppoy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RE92_05825
Exosome [BR:ppoy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RE92_05825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AJE50610
Position
1307184..1308368
Genome map
AA seq 394 aa AA seqDB search
MKKVAIVSPLRTAVGSFNKTLAPLSAPELGATVMTACLQQSKLEPSLIDQIFMGNVLQAG
NGQNPARQAALKAGIPIDVPESTINTVCGSGLHAVALAYDSILAEQGNIVLAGGMESMSN
APYLLKNARNGYKLGNGELVDSLVADGLTCPINHYHMGITAENVAEKYGISRLEQDSFAY
ESQIKAFEAKNNKFFEEQIVPVMIKNKKETTYFTEDEHIRGNTTKEKLSNLKPAFKENGT
VTAGNASGINDGAAAMLVVSEDKCKEHALKPLAYIKGYSLVGVDPAYMGMGPVKAISSLL
KKQGMSIDDIDLFEINEAFAAQALAVQKELGVSPEKVNVNGGAIAIGHPVGASGARVLVT
LVHEMVRRSSRYGVVSLCIGTGMGIAMLVENALI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtagctatagtaagcccgttgagaacagcggtcggttcttttaacaaaacc
cttgcgcctctaagcgctcctgaattgggagcaaccgtgatgacagcatgccttcagcaa
agtaaattagagccttctttgattgatcaaatttttatgggaaatgttcttcaagcgggc
aatggtcaaaatcctgccagacaggcggcactaaaagcgggtatccccattgatgtaccc
gaatcaacgataaacacggtttgcggttcaggacttcatgccgtcgcgttagcttacgat
tcaatattggcggagcaaggaaacatcgtcttggctggaggcatggagagcatgtcgaac
gccccttatctgctaaaaaatgcaagaaacggctacaagcttggcaacggtgaattggta
gactccctggtggctgacggcctaacatgcccgatcaaccattaccatatgggaattacc
gccgaaaatgttgccgaaaaatatggaatctcaagactggagcaagattcattcgcctat
gaaagccagataaaggctttcgaagcaaaaaacaacaagttttttgaagagcaaattgtt
ccggtcatgatcaaaaacaaaaaagaaactacttatttcacagaagacgaacacataaga
ggaaatacgacgaaagaaaaactttcaaacttgaagcctgcgtttaaagagaacggaacg
gttactgccggaaatgcttcgggaatcaatgatggtgcggcagctatgttagtcgtgtcg
gaagataaatgtaaggaacatgcgttaaagccgttggcatatatcaagggttattcgctt
gttggtgttgaccctgcatatatgggaatgggaccggtaaaagccatttcgtcactgctg
aagaaacagggaatgtcgattgatgacattgatctctttgaaattaatgaagcgttcgct
gcacaagcactagcggtgcaaaaagagctgggagtcagtccggaaaaggtcaatgtcaat
ggcggcgcgatcgcaatcggtcatcctgttggtgcaagcggtgctagggtattggttacg
ttagttcatgaaatggtgcgcagatcttcacgttacggcgtagtctcgttatgcatcgga
acgggaatgggaatagcaatgctggttgaaaatgcactcatttaa

DBGET integrated database retrieval system