KEGG   Paenibacillus polymyxa Sb3-1: RE92_23075Help
Entry
RE92_23075        CDS       T03812                                 

Definition
(GenBank) SAM-dependent methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
ppoy  Paenibacillus polymyxa Sb3-1
Brite
KEGG Orthology (KO) [BR:ppoy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ppoy03009]
    RE92_23075
Enzymes [BR:ppoy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     RE92_23075
Ribosome biogenesis [BR:ppoy03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    RE92_23075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsJ Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_24 Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: AJE54141
Position
5222122..5223180
Genome map
AA seq 352 aa AA seqDB search
MNTDEQSECALSSSRFVCTANHGFAPYAQEELRRLFGSVKSTMLLPGEIFLATLPAGEIE
TVRTITGQPPMFLRHLFPVHFQEEGTDLVQVQERLVAFIRNRRELIDQRVSLQVRKGTNS
SWTESAGALRLALSEQLSDLPMELVVQGADVIVSVFADTDTWYAGVSHPQDNLSDWSGGA
VRFQKEDGQISRAKFKLLEAEATFGIDFSAFHQGLDIGAAPGGWTSFLLERGLKVTAVDP
AKMEPSLMKYANLTFLRKNASEVKFKENSFDLLVCDMSWSPKQMARLVTDLLYSLRSGGT
AIVTVKLMHKKPLALIHDVIASFEESGMQIQRAKQLFHNRDEITLYMIKYGK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagatgaacagagtgaatgcgctttgtcatcatcaagatttgtttgtacggcc
aatcatggttttgcaccctatgctcaagaggagcttagaagattatttgggtctgtaaaa
agtacaatgcttctacctggtgaaatttttttagcaacactacccgcgggagaaattgaa
acagtgaggacgattacaggccagccaccaatgtttcttcgccacttgtttcctgttcat
tttcaggaggaaggaacggatctggttcaagtgcaagagcgtctggttgcatttatccgt
aaccgcagggaactgatagatcaacgtgtttctttgcaagtacgcaaaggaactaatagc
agttggactgaaagcgcaggtgcactcaggctggctttgagtgaacaattaagtgatcta
cctatggagttggtggtacaaggcgccgatgttattgtgtccgtttttgcagatacggat
acgtggtacgcaggcgtatcacatcctcaggacaacctatcggattggagtggaggtgca
gttcgttttcagaaggaagacggacagatctctcgtgccaaattcaagctactggaagca
gaagcaacgttcggtattgattttagcgctttccatcagggactagatattggggcagca
ccgggtggatggacttcctttttgctggagcgtggactgaaagttacagcggttgatccg
gccaagatggagccatcgctgatgaagtacgccaatctgacgtttttgcgtaaaaatgca
agtgaagtcaaatttaaagaaaattcgttcgatctgctggtttgtgatatgagctggagc
ccaaaacagatggcaaggctcgttactgatttactatatagtttgcggagtggtggtacg
gctatcgtaacagtcaagctaatgcataaaaagcccttggcgctcattcatgatgtgatt
gcttcatttgaggagtccggcatgcagattcagcgagctaagcagcttttccataaccga
gacgagattaccctgtatatgatcaagtatggaaaataa

DBGET integrated database retrieval system