KEGG   Physcomitrella patens subsp. patens: 112272650Help
Entry
112272650         CDS       T01041                                 

Definition
(RefSeq) probable leucine-rich repeat receptor-like protein kinase At5g49770 isoform X1
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
ppp  Physcomitrella patens subsp. patens
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ppp01001]
    112272650
Enzymes [BR:ppp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112272650
Protein kinases [BR:ppp01001]
 Serine/threonine kinases: TKL group
  IRAK family
   112272650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase LRR_4 LRR_8 LRRNT_2
Motif
Other DBs
NCBI-GeneID: 112272650
NCBI-ProteinID: XP_024356390
Position
19
AA seq 1025 aa AA seqDB search
MYGGGSMRAWLSVALVVACLGWTLSAAVTDPGDVKVLLKLKKAWGGGLSLWSGLDPCYDG
WLGVFCDDKNTRVTSLYLISADLAGTIPPEIGSLSALVNLDLSFNTNLKGQLPSELGSLT
NLLYLSLQKCSFSGRIPESLGKLEKLTFLALNNNGFSGELPSALGALSKLKWFDVAYNKL
EGSLPVSTSSKDSLGLDTWPDIEHYHLNDNQFSGIIPPELGNAAKCLHMLLEANSFTGPI
PESFGNLSSLQILSLHYNQLAGPIPSTLSKIIKFGKYAGLHQIRVSNNQLSGTLPNLNAL
NQLEYVDFSNNLFDPQPFPKWLNESSEELQTIKCENCSWVGPLPADILAYPSLQGLYLQH
NRLNGSLTIPVNLGKKLQYVSLQNNGISVVNPQNPNAELPQIQLEDNPICSGEGLLRAGP
TLCSTEANSNGANEILTWISSLTTNNSCPSLCRNANHVLNPYTCHCGYPLVVTLEIRAPI
SSIVNDTSLWDLLKAQTYDSLRNLTSQIKPPLELDSEQLWVYQAQHANHSKVHVRLYIFA
PVGAEVMDRRTDNLIKGWFTTQKVEYTSPFKPEFVIDIEPSQEAGSVTFGVSKLAIIGIA
TGAGALLALLGFLVSVALRQKRRFEEERKNNPFGAWAKAEDGNAPQLKGARWFTFNDMRR
MTNDFDDDNMLGAGGYGKVYKGVMAETGVILAVKRAQEGSKQGADEFKNEIELLSRVHHN
NLVGLVGFCYDKAEQMLVYEFVPNGSLTDWLRGLKSNQPLDWDRRLLIALGAARGLTYLH
ENAEPPIIHRDVKSCNILLDMSMNAKVADFGLSVMVSSVNDNKRDETIRGTMGYLDPEYY
ATNIMSSKSDVYSFGVVLLEIFTGRPPVSREGHIVTEFRKIIAKSGVTGVFELLDLVLVG
TPVHDLDTFLKIALECVEDTPTERPSMYEVVKQLEALIGPKSLLSSGGEDPFIAQMAKAK
KPRVPLQIFSSALEDFRPTSERRLQPSASSHRSSSSFKQATNLRGVSSFTIFLLFDFVNS
LKYSQ
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atgtacggcgggggttcaatgagggcatggctcagcgtcgcgcttgtagttgcgtgtttg
ggttggacactgtctgctgcagtcaccgatcctggcgatgtaaaagttctgctcaagttg
aagaaagcatggggtggcggcctgtcgctctggagcggtttagatccttgctacgacgga
tggttgggtgtcttctgcgacgacaagaataccagagtaacatccttgtacttgataagc
gcagaccttgcgggaaccattcctccagaaataggatcactttcggctcttgttaatctg
gatctttcgttcaacacgaatttaaaaggacagttaccttctgagctgggttccttgact
aatttactctatctgagtttgcaaaagtgcagtttctcagggcgtatccctgaatctctg
gggaagttggaaaaattgactttcttagctttgaacaacaatggattcagtggagaactt
ccttcagctcttggtgcactatccaagctgaagtggttcgacgttgcctacaataagttg
gaggggtctttacctgtctcaacaagcagtaaagactctctaggtcttgatacctggcca
gatattgaacactatcatttgaatgacaaccaattttccggcatcattccacctgaactt
gggaacgccgcgaagtgcttgcacatgctactggaggcgaattcattcactggacccata
cccgaatcctttggaaatctctccagtcttcagatcctaagtcttcattacaatcaacta
gctggtccaattccctctacgctaagtaaaatcattaaatttgggaaatatgctgggcta
catcaaattcgtgtttccaacaatcagctgtcaggaactctgccaaatttgaatgctctc
aaccaacttgaatacgttgatttcagcaacaatctttttgatccacaaccttttcccaaa
tggttgaatgagtcttccgaagaacttcaaactataaaatgcgagaattgcagctgggtt
gggcctcttcctgctgatattttggcatacccctcacttcaaggcctgtaccttcaacat
aatcgactgaacgggtccctcacgatcccagtgaacttgggaaagaagttgcaatacgtc
tctctccaaaacaacggaatttcagttgtcaacccacaaaatccgaacgctgagttacca
caaattcagttggaggataatccgatatgctctggtgaaggactcttgcgagcaggcccc
actttatgttcaactgaggcgaactcaaatggggcaaatgagattctaacatggatctcg
tctcttacaactaacaatagttgcccctccttgtgtcgaaacgccaatcacgtcttaaat
ccgtacacttgccattgtggctacccccttgttgtaacacttgagatccgagcgccaatc
tcctcaattgttaatgatacgagtttgtgggacttgctgaaggctcaaacatatgattca
ctaaggaacctcacatctcagattaaaccaccattggaattggacagtgagcagctatgg
gtatatcaagcccaacatgcaaatcactctaaagtccatgtcagactatatattttcgca
ccggttggagccgaagttatggaccggcgaaccgataatttaatcaagggttggttcacg
actcaaaaagttgagtatactagccctttcaagccggagtttgtcatcgatattgaacct
tctcaagaagcgggatctgtgacgtttggtgtctcaaagttggccataatcggcattgct
actggagctggagcgctgttggcacttctcggattccttgtttcggtagcattaaggcaa
aaacgcagatttgaggaagaacgaaagaacaatcctttcggtgcatgggcaaaagctgaa
gatggcaatgcacctcaactgaaaggagctcgctggttcactttcaatgatatgaggaga
atgacaaatgattttgacgatgacaatatgctcggggctggagggtatggcaaggtatat
aagggtgttatggcggaaacaggtgtaatactcgcagtgaaaagggcacaagaaggttcc
aaacaaggtgccgacgaattcaaaaatgagatagagctcttatcccgggttcaccacaac
aatctagttggacttgtggggttctgctacgataaggctgagcagatgcttgtgtatgag
ttcgtgcctaatggttctctgacagattggcttcgtggattgaaatcaaaccaacctctt
gattgggacaggcggctcttgatagcactgggtgcagccagaggcttaacgtacttgcat
gagaatgcagaaccaccaataattcacagggatgtcaaatcgtgcaacattctgctggac
atgagcatgaatgctaaggtcgctgattttggtctttcggtgatggtttccagtgtgaac
gacaacaaacgtgatgaaacgatcaggggcacgatgggttacctcgatccggagtattac
gccacaaatattatgtcctcaaagagcgatgtttatagctttggagtggttctacttgag
atttttacgggcagacctccagtcagtcgagaaggccacatcgtcacagaattcaggaag
ataatagccaaatcaggggtaaccggtgtcttcgagctgcttgaccttgtgcttgttggc
actcccgtgcacgacctggacacgtttctgaagatagctctagaatgtgtggaagatact
ccaactgagagacccagcatgtacgaagtggtgaagcaactggaggctcttataggacct
aaatccctcttgtcatctggtggtgaggacccctttattgcacagatggcgaaggcgaag
aaacctagagtaccattgcaaatcttcagttccgcattggaagatttcaggcctacttct
gaacgacgtttacagccatcagcatcctcacatcgatcctcgtcctcgttcaagcaggct
acaaacttgcgtggtgtcagcagttttactatctttctactctttgattttgtaaactct
ttaaaatattctcagtag

DBGET integrated database retrieval system