KEGG   Physcomitrella patens subsp. patens: 112276317Help
Entry
112276317         CDS       T01041                                 

Definition
(RefSeq) farnesyl pyrophosphate synthase 2-like
  KO
K00787  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp00900  Terpenoid backbone biosynthesis
ppp01100  Metabolic pathways
ppp01110  Biosynthesis of secondary metabolites
Module
ppp_M00366  C10-C20 isoprenoid biosynthesis, plants
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    112276317
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:ppp01006]
    112276317
Enzymes [BR:ppp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     112276317
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     112276317
Prenyltransferases [BR:ppp01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   112276317
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-GeneID: 112276317
NCBI-ProteinID: XP_024363271
Position
24
AA seq 360 aa AA seqDB search
MDSVAAVPSALVEKKSNAAGREKFMDVYQQLKKEILSDSELVTYTEESRAWVEEMLDYTV
PGGKLNRGLSVVHSLELLKKDTPLSEQDTFNACALGWCIEWLQGYFLVMDDIMDNSVTRR
GQPCWYRVPKVGLIAINDGIILRTHISRVLKRHFRQSPIYVELVDLFNDVEYQTASGQML
DLITTPAGEVDLSKYVLPTYLRIVKYKTAYYSFYLPVACALLLAGETSVAKFEAAKEVLV
QMGTYFQVQDDYLDCYGAPEVIGKIGTDIEDTKCSWLIVQALKRANESQKQLLKEKYGKK
DPACVVEVKRVYNELELQKVFEDYERDSYVKLIADIEKLDDQALQVVLKSFLAKIYKREK
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggattccgttgccgctgttccctctgcgttggtggagaagaagagcaatgcggcaggc
cgggaaaagtttatggacgtttaccagcagctgaagaaggagattctgtctgattccgag
cttgtcacatacacggaggagtctcgtgcttgggttgaagagatgctggactatactgtg
cctggaggaaaattgaacagaggtttgtcagtcgtccacagcttggaacttttgaagaaa
gatacaccactttctgagcaagatacattcaatgcgtgtgcccttggttggtgcattgag
tggctgcaaggctacttcctagtcatggatgacattatggacaattcagtcactcgtcga
ggacaaccttgctggtaccgcgttccaaaggttggcctcattgctatcaacgatggaata
atcttgagaacgcatatctctcgtgttctgaagagacatttccggcagtccccaatctat
gtggaacttgtcgacttattcaatgatgtcgagtatcagacagcctctggacagatgttg
gacctgatcaccactccagcaggagaagttgatttgtcgaaatatgtattacccacttat
ctgcgaatcgtaaaatacaaaactgcatattattcattttatcttcctgtggcatgtgcc
ttgcttttagctggggagacgagcgtggccaagtttgaggcagctaaggaagtccttgta
cagatgggcacatacttccaagtccaggacgactatcttgactgttacggcgcgccagaa
gtgattggaaagatcggaactgacattgaagacactaaatgttcctggctgatagttcaa
gccttaaagcgtgccaatgaatcccagaaacagttattgaaggaaaaatatggaaagaag
gacccagcgtgcgtagttgaagtaaagcgcgtttacaatgaacttgaactccagaaagtg
ttcgaggactatgaacgcgacagctacgtaaagcttattgctgacatcgaaaagttagat
gatcaagccttgcaagtggttttgaaatcatttttggccaaaatctacaagcgcgaaaag
tag

DBGET integrated database retrieval system