KEGG   Physcomitrella patens subsp. patens: 112276329Help
Entry
112276329         CDS       T01041                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp00010  Glycolysis / Gluconeogenesis
ppp00562  Inositol phosphate metabolism
ppp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112276329
   00562 Inositol phosphate metabolism
    112276329
Enzymes [BR:ppp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     112276329
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     112276329
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 112276329
NCBI-ProteinID: XP_024363321
Position
24
AA seq 503 aa AA seqDB search
MAKRRFELGLWVGLILLVDFVCGTVALAKFDVRQHISSTTSYEAGRRIEYGNEIVSSPEG
CVPVHINLVARHGVRRPTEKRIKELEGFADRLRVLSAEAAKNQNETTSLPPAWIKEWKSP
WSDKQIGGELLPKGEEELYDLALRYKSKYPEIFSEQYHPDVYPIIATQVGRSSASSVAFG
MGMFAGQGTLGAGKQRAFSVITESKGHDVHLRFHDTCMAYKESKKLRKPKVAGWQAGVYD
LVAKSVQGRYSLAVNNSDVATLWLLCKNEASLLDIVDQACGMFTTEEIEWLEWADDLGTH
HLKGYGDTLNYRMGVPLLNDVVKTMDRVIADAQSKKTTEKARLRFAHAETVIPFSCLLGL
FLEGTDIKSIQSEEPLKAPPRPPHQRTWRGALVTPFAANTALVLHKCSTDNGAGMKYFVQ
ALHNERPVIMPACNGTHFCPIETFKEHVVAPHTKRSYESLCKMEVVHEPVHDTFLSKFFY
IPSHLFRWLFRSAPAQGDCHTDL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcgaagatttgaactgggtttgtgggtgggtttgatattgctggtggatttt
gtttgtgggactgtggcgctggcgaagttcgatgtgaggcaacatatctccagtaccacc
agttatgaagctgggagaaggatcgagtatgggaatgagattgtgagctcaccggagggt
tgtgtccccgttcatatcaatctcgtggcaagacatggagtacgcagacctaccgagaag
aggatcaaggagttggaaggttttgcagacaggcttcgtgttttatctgcggaggcagct
aaaaatcaaaatgaaactacgtccctaccgcctgcgtggatcaaagaatggaagtcccca
tggtcggacaagcagattggaggggaattgttgccgaaaggtgaggaggagctctatgac
ttggcgttgcgttacaagtccaagtatccggagatattctcggagcagtaccaccccgat
gtatatccaataattgctactcaggtcggcagatcctcagcaagttccgtggcttttgga
atgggaatgtttgctggtcaggggacgctaggtgcagggaagcagcgtgctttctctgtt
attactgaaagcaaggggcacgacgttcatcttcgcttccacgacacatgtatggcttac
aaggaatcaaagaaattgcggaagcccaaagtagctggttggcaagcgggagtatacgat
cttgttgctaaatcagtgcagggtcggtatagtttggcggtcaacaacagtgacgtggcc
actctttggttattatgtaaaaatgaagcttctcttttggatatcgttgatcaggcttgt
ggaatgttcacaactgaagagatagagtggcttgagtgggccgacgacctagggactcat
cacttgaaaggttatggagatacgttgaactaccgtatgggcgttcctttgttaaatgac
gtggtgaaaacaatggatcgtgttatagcagatgctcaatccaagaagacaacggagaaa
gccaggttgcgttttgcgcatgcagagacagttataccgtttagttgtcttcttggcttg
tttctagaaggcactgatataaagtcgattcaaagtgaagaaccgttgaaagctcctcct
agacctccacatcagcgcacatggcgtggtgctcttgtgacgccctttgcagcaaacaca
gctttggttcttcacaagtgttctacggataatggggctggaatgaaatactttgtgcag
gctttgcataatgaaaggcccgtgatcatgcctgcatgcaatggtacacatttctgccca
attgaaacctttaaggaacatgtggttgcgccacatacgaagcggagctatgaatcactg
tgcaagatggaggtggtccacgagccagttcatgacacatttttgtcgaagttcttctac
attccgtcgcacttgtttcggtggcttttccgttcagctcctgctcaaggggattgtcat
acagatctgtaa

DBGET integrated database retrieval system