KEGG   Physcomitrella patens subsp. patens: 112276579Help
Entry
112276579         CDS       T01041                                 

Definition
(RefSeq) thiamine thiazole synthase 4, chloroplastic-like
  KO
K03146  cysteine-dependent adenosine diphosphate thiazole synthase [EC:2.4.2.60]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp00730  Thiamine metabolism
ppp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    112276579
Enzymes [BR:ppp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.60  cysteine-dependent adenosine diphosphate thiazole synthase
     112276579
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thi4 DAO FAD_binding_2 NAD_binding_8 Pyr_redox_2 GMC_oxred_N FAD_oxidored Lycopene_cycl HI0933_like GIDA NAD_binding_9 Pyr_redox_3 FAD_binding_3 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 112276579
NCBI-ProteinID: XP_024363763
Position
24
AA seq 362 aa AA seqDB search
MAAVMGVHAVGAATGFATGVEIKKNLASSANSLSGVRMVAASTAQMMKQTRVPVVSASLY
SDAKYDLNNYKFDPIKESIVAREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYELSKNP
NVKVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDEIEVPYEEMENYVVIKHAALFT
STIMSKLLARPNVKLFNAVAAEDLIIRGDRVSGVVTNWALVAQNHNTQSCMDPNVMEAKV
VVSSCGHDGPFGATGVKRLRSIGMIESVPGMKCLDMNAAEDAIVKHTREIVPGMIVTGME
VAEIDGSPRMGPTFGAMMISGQKAAHLALKALGLPNEVDGNYKPNVHPELVLASTDDMTA
SA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagtcatgggtgtgcatgctgtgggagcggccactggattcgccacgggggtc
gagattaagaagaaccttgcgtcgtcggcgaactccctgagcggcgtcaggatggtcgcg
gcttctactgcccaaatgatgaagcagactcgggtgccggtcgtgagcgcgtccctttac
tccgatgctaagtatgacttgaacaactacaagttcgaccccattaaggagtccatagtt
gcccgggagatgacccggcgctacatgaccgacatgatcacccacgctgatactgatgtg
gtggtggtgggagctggctctgccggcttgtcgtgcgcgtacgaattgtcgaagaacccc
aacgtgaaggtggcgatcatcgagcagtcggtgtcacccggcggtggtgcgtggctcgga
gggcaattgttctcggccatggttgttcgcaagccagcgcaccggttcttggacgagatc
gaggtgccgtatgaggagatggagaactacgtggtgatcaagcatgcggctctgtttacg
tccaccatcatgagcaagctgctggctcgcccgaatgtgaagctgttcaatgccgtcgcg
gcggaggacttgatcatcaggggcgaccgagtgtctggagtggtgacgaactgggccctc
gtggcgcagaaccacaacacacagtcgtgcatggaccccaatgtcatggaggcgaaggtt
gtagtttcatcgtgcggtcacgatggtccatttggcgccaccggagttaagaggctgaga
agcattggcatgattgagagcgtgcctgggatgaagtgtctggacatgaatgccgcagag
gacgcgattgttaagcacacccgggagatcgtgcccggcatgattgtgacgggaatggag
gtcgctgagattgatggttcaccgagaatgggaccaacattcggagccatgatgatctcc
gggcagaaggccgcgcatttggctttgaaggcgctgggacttcccaacgaggtggacgga
aactacaagcccaacgtgcaccccgagcttgttctcgcttctactgatgatatgactgct
tctgcctag

DBGET integrated database retrieval system