KEGG   Physcomitrella patens subsp. patens: 112277037Help
Entry
112277037         CDS       T01041                                 

Definition
(RefSeq) NADPH--cytochrome P450 reductase-like
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
ppp  Physcomitrella patens subsp. patens
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    112277037
Enzymes [BR:ppp01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     112277037
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1 Tubulin
Motif
Other DBs
NCBI-GeneID: 112277037
NCBI-ProteinID: XP_024364765
Position
24
AA seq 683 aa AA seqDB search
MTTTTGMALSFMPPFFSIFEVWACLLLVGTVAFFVWRQQGAKPVKPVVVVAKPVAPIEDE
VEENSSVKRVTVFFGTQTGTAEGFAKAIVEEAKSRYEGSAVFKVLDLDDYAADDEQYAAR
LKKEKFALFMVATYGDGEPTDNAARFYHWFIENGEELELHLSELRFGVFGLGNRQYEHFN
KVAKKIDTAFAKHGAKRIVEVGLGDDDQSIEDDFAAWKEKLWPELDVLLKDPEDSQATTP
KTAYLAAVAEYRTVIYEPGTKLHVEEYSGKKIGQAAYDAVHPCKAEVAFVKELHSPESGR
SCTHLEFDIANTGLSYETGDHVGVYVENSRDDVEEAAKYLGMPLDTIFSLHVDAEEGQLL
AGSLPPPFPGPLLLETALRRYTDLLNPPRKAVLMALAAFASDPEEAERLTYLASLKGKEE
YSKWVVQSQRSLIEVLAAFSSVKLPLGVFFASVAPRLQPRFYSISSSPKLSPSRIHVTCA
LVHGPSPTGRIHRGVCSTWMKNAQSNEACSADGCSWAPIFVRQSNFRLPADSSTPVVMVG
PGTGLAPFRGFLQERAALQESGSMLGPAKLFFGCRSRTQDFIYEDELKSYVEKGVMELTV
AFSREGSKKEYVQDKMLEQAGEVWSLIKGGGYLYVCGDAKGMARDVHRMLHTIVQQEEGA
EGSKAEAIVKQLQVDGRYLRDVW
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgaccactaccacaggtatggcgttgtcgttcatgccgccattttttagcattttcgag
gtttgggcgtgtttgcttctagtggggacggtggcgttcttcgtgtggaggcagcaagga
gcgaaacctgtgaagcccgtggtggtggtggcgaagcccgtggcgccgattgaggatgaa
gtggaagaaaacagctctgtgaagcgagtgacggttttcttcgggacgcagacgggtaca
gcggagggcttcgctaaggcgattgtggaagaggctaagtcgcggtacgagggctctgcc
gtgttcaaggttttggatctcgatgattacgccgcggatgatgagcagtatgcggcgagg
ttgaagaaggagaaatttgcgttgttcatggtggcgacttatggggatggcgaacctact
gataacgcggcgcggttttaccattggtttattgaaaacggagaggagttggagctacat
ttgagcgagttgaggtttggagtgttcggtctgggtaaccggcagtacgagcacttcaac
aaagtggctaaaaaaatcgatactgcattcgcgaagcatggtgcgaagcggattgtggaa
gtcggtctcggcgacgacgatcaatccattgaggatgactttgccgcatggaaggaaaag
ctctggccggaacttgatgttctgttaaaagaccccgaggactcacaagccactaccccg
aagactgcttatcttgctgctgttgcggagtatcgcacagtgatttacgaacctggaacg
aagcttcatgtggaagagtactctggtaagaaaattggacaagccgcttacgatgctgtt
catccgtgcaaggcggaggtggcgtttgtgaaggagcttcatagccctgaatcaggcagg
tcttgcactcacttagagtttgacatcgctaatacgggactgtcctacgaaactggtgat
catgtcggagtctatgtggagaatagtcgggatgatgtggaggaagccgccaagtacttg
ggaatgcctcttgatacaattttctcgcttcatgtggacgctgaagaggggcagctactg
gctggatctcttcccccgccatttccaggtccattgttgctggagacagctttgcgtcgt
tacactgatttgctcaaccctccgaggaaagccgtgttgatggcattggcggcttttgca
tctgacccggaagaagctgaaagattgacatatctagcttctctgaagggtaaggaagag
tactccaagtgggtagtgcagagccagcggagcttgatcgaggtattggccgccttttcc
tccgttaagttgccacttggtgtcttcttcgcgagtgttgcgcctcgtttgcagccacga
ttttactcaatctcgtcatcccccaaattgtccccttccagaattcacgtcacttgtgcg
ctcgtccatggccctagccccacgggacgcatccaccgtggtgtttgttccacctggatg
aaaaatgcacagtctaatgaagcttgtagcgcggatggctgcagctgggctcccattttt
gtgcgccaatccaatttcaggttacccgcagactcctctactccagttgtaatggtaggc
cctggaactggcttggcaccattcagggggttcttacaagagagagctgctcttcaggaa
tcagggtcaatgcttgggccggcgaagctcttctttggatgccgatcacgtactcaagat
tttatttacgaggacgagctcaaaagttatgttgagaaaggagtgatggaactcacagta
gcattctccagggagggttccaagaaggagtatgtccaggacaaaatgcttgagcaagca
ggagaagtgtggagtttgattaagggtggtgggtacttgtacgtctgtggtgacgcgaag
gggatggcgagagatgtgcacaggatgctgcacactattgttcagcaggaggagggcgca
gagggctcgaaggctgaggcaattgtgaagcaactccaggtggacgggcggtatctgcgc
gatgtctggtag

DBGET integrated database retrieval system