KEGG   Physcomitrella patens subsp. patens: 112277320Help
Entry
112277320         CDS       T01041                                 

Definition
(RefSeq) probable histidine kinase 6
  KO
K14489  arabidopsis histidine kinase 2/3/4 (cytokinin receptor) [EC:2.7.13.3]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04075 Plant hormone signal transduction
    112277320
Enzymes [BR:ppp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     112277320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CHASE HATPase_c Response_reg HisKA Pga1
Motif
Other DBs
NCBI-GeneID: 112277320
NCBI-ProteinID: XP_024365241
Position
25
AA seq 1075 aa AA seqDB search
MSTRSGAKRGSDSSPCISNGSSKSKVVLRGGNGIYMHRATGSGRLGVKWWKDSGITCIKP
KQKDSEAGSRYGHNWHTIAFIMWVVFMGAVSVSVYFAMRFDMLERRRENLANMCEGRARM
LEEQFKASMNHVRALTALLTTFHLGKQPSAINQETFATYAERTAFERPLMSGVAYAERVL
HANRNLFESKHGWTIKEMFSKEKQRDFDEYAPTTMTQETLSHLTSLDMMSGQEDRENIIR
ARESGKGALTNPFRLLESKHLGVVFTFAVYTTDLPEDATKEDRIKATAGYLGGAFDVETL
VENLLRQMAGSQIIAVNVYDITNETMPLVMYGYTNVEKMQSTYVSDLDFGDPARRHEMRC
RFKEDALPPWTAISTSIGIFVIAFLVGHMLHASRNRIDKVEENCRIFQELKMRADDAVIA
KSQFLATVSHEIRTPMNGVLGMLQMLIDTPLNPAQLDYAQTALASGKALINLINEVLDQA
KIESGRLEFEHVPFDLRAILDDVLSLFHGKSRASGIELAVYVSARVPKILVGDPGRFRQI
ITNLVGNSIKFTEAGHIFVCVHLNEDVNMVMDGSGGDADDTMDGEVESAGPLNDMNYRFN
TLSGRETADYRNSWEMFERLLAQEQSHNDTWSYSDSSDVVNLVVSVEDTGVGIPLHVQDR
VFTPFMQADSSTSRNYGGTGIGLSISRCLVELMSGEMGFVSRPKVGSTFTFTVELQRVPA
NIPERILREGRNSYLQTPPLTTCFQGMRVLVVDGRKVRCEVTRHHLKRLGLQVEVAHTVS
EAAEILSTVADQGTCSSRGSRGSLAGNIEMIFVDKDAWGPGTGMNFRSLLGESAIGHLGY
QSSRTSYQYRTSGRIPFGYPVIQSMKRMVLVATSMTDMELGMVKASGFVDTVVRKPLRAS
LIAACLKQILGVGDRSRDQEQELRSGVTSLQTLLYGKRILVVDDNPVNRKVAAGALHKYG
AQVECVYSGRAAIQKLKPPHNFDACFMDVQMPEMDGFEATGLIRKAEAAAAERGQAAGLP
TFKRRLHVPILAMTADVIQATSEECMRCGMDGYVAKPFDEHQLYQAVAKHFFDVN
NT seq 3228 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccaggagtggagccaagaggggctcagactccagtccctgcatctccaacgga
agctctaaatcaaaagttgtgctgagaggtgggaatggaatatacatgcacagggctact
ggctctggacggctaggggtaaaatggtggaaggattcaggaattacctgtattaagcct
aaacagaaggattctgaagctggatccaggtatggtcataattggcatactatagcattc
atcatgtgggtggtttttatgggtgctgtttctgtgtccgtttatttcgccatgagattc
gacatgcttgaacgaagaagagaaaatcttgcgaacatgtgcgagggacgggctcgtatg
cttgaggagcaattcaaggcaagtatgaaccatgtcagagcactcacggctcttctcact
acttttcatcttggcaagcagccctcagccatcaatcaggaaacctttgctacctatgct
gaaagaacagcatttgaaagaccgttgatgagtggggttgcatatgccgagagagtcctt
catgcgaatcgaaacttgttcgagtcgaaacatggctggactatcaaggaaatgttttct
aaagaaaagcagcgagattttgacgaatacgccccaactaccatgactcaagagactctc
tcccatttgacgtctcttgatatgatgtctggtcaggaagatcgcgaaaatatcatacga
gcgcgagagtcgggaaaaggagctttgacgaaccccttcaggttactggagtctaagcat
cttggagtagtgtttacgttcgctgtatacaccacagacctgccagaagatgcaacaaag
gaggaccgaattaaagcaaccgctggttatctgggtggagcctttgacgtcgaaacgctt
gtggagaatcttcttcgacaaatggctggtagtcagattattgcggtcaacgtatatgac
attacaaatgaaacgatgcctcttgtgatgtatggctacaccaacgttgaaaaaatgcaa
agcacatatgtcagcgacttggactttggagaccctgcccgtaggcatgaaatgcggtgc
aggtttaaagaggatgcgttgcctccttggacagccatatccacttctataggtatattt
gtaatcgcatttttggtcggacacatgctacatgcttcaaggaaccgaatcgataaagta
gaagaaaactgtcgcatatttcaggagcttaagatgcgtgcagatgatgctgttatagcg
aagtctcagttcttggcaactgtgtctcacgagattcggactccaatgaatggtgttcta
ggaatgcttcaaatgttgatagacactccgctgaatccagcgcaattagactatgcccaa
actgctttagccagtggaaaagcacttatcaacctcataaatgaggtccttgatcaggct
aagattgaatcgggccgtctagaatttgagcatgttccctttgatttgcgtgccatcctt
gacgatgtgctctccctcttccatggaaaatcaagagcttcgggcatcgagttagcggtt
tacgtttctgcgagggttcccaaaattctcgttggtgaccctggtcgttttcggcagatc
atcaccaatctcgttggcaattccatcaaattcaccgaagctggtcacatttttgtttgc
gttcatttgaatgaagacgtcaacatggtgatggatgggagtggaggtgatgctgacgat
actatggatggggaagttgaaagtgccggaccgctgaatgacatgaactaccgatttaac
acccttagtggcagagaaactgctgattaccgaaacagctgggaaatgtttgagcgactg
cttgcgcaagaacagtcacacaatgatacttggagttactccgactcgagcgatgttgtg
aatctggtggtcagtgtggaggatacaggtgtgggtatacccttacacgtacaagaccgt
gtctttacccccttcatgcaggctgacagctcaacatctagaaattacggaggcactgga
ataggactaagcatcagccggtgtttagtagagcttatgtcaggggagatgggctttgtt
agtcgtcctaaagtggggtccacattcacattcactgtggaattgcaacgtgtacccgcc
aatatacccgaaaggatccttagagagggcaggaacagttatctacaaacgccgccacta
actacttgtttccaaggaatgcgtgtactcgttgtggatggcagaaaagtccgctgtgaa
gtcactcgccatcatttaaagaggctcggactccaggttgaggtcgcccacactgttagt
gaggctgccgagattctttctacagtggctgaccaaggcacttgcagctcaaggggttca
cgtggctccttggcaggaaatatcgaaatgattttcgtggacaaggacgcttggggtcct
ggaactgggatgaattttagaagcttgcttggtgaaagtgctatcggccacttgggctac
caaagctcgcgaactagttaccagtatcgcacatcaggcagaattccctttggataccca
gtgattcaatccatgaagaggatggttctagttgcgacatcaatgacggatatggagctt
gggatggtgaaagccagcggatttgtggatactgttgttaggaaaccacttcgagcaagc
ttgatagctgcttgtctcaagcagattcttggggttggggacaggagccgagaccaagag
caggagttgcggagtggggttacttctctacagactcttttatatggaaaacggattctc
gtggttgatgataatcccgtgaatcgaaaggttgcagctggggctctgcacaagtatggg
gctcaagttgagtgtgtttacagtggaagagctgctatccagaagttgaagcctccccac
aatttcgatgcctgttttatggacgtgcagatgccagaaatggatggtttcgaggctaca
gggttaataaggaaggcggaggctgcagccgcagagagaggccaagcagcgggattgcca
acctttaaacgccgactgcatgtgccgatcctggcaatgacagctgacgttattcaagct
acctccgaagaatgtatgcgctgtggcatggatggctacgtggctaagccatttgacgaa
catcagctttaccaagcggttgccaagcatttcttcgacgtgaactaa

DBGET integrated database retrieval system