KEGG   Physcomitrella patens subsp. patens: 112277674Help
Entry
112277674         CDS       T01041                                 

Definition
(RefSeq) glutathione S-transferase T1-like isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp00480  Glutathione metabolism
ppp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    112277674
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ppp02000]
    112277674
Enzymes [BR:ppp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     112277674
Transporters [BR:ppp02000]
 Other transporters
  Pores ion channels [TC:1]
   112277674
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_N_4 GST_C_3 GST_C
Motif
Other DBs
NCBI-GeneID: 112277674
NCBI-ProteinID: XP_024366034
Position
26
AA seq 257 aa AA seqDB search
MAPSGNLKLYADLMSQPSRAVLLFCRVNNIDVDQQLINIQKGDHKTPEFKAINPLGKVPC
IVDGRFKLAESHAIMEYLAATRPGVADHWYPTDVQRRSKINSVLDWHHLNLRRGSMTLVF
HKVLAPIVGVKADPRAAAEGLSILQQSLQVLETVWLQEGYPFLAGGRQPSIADLSLVCEI
MQLQVLGEEEVAALLSSKERVTAWIAAVKKATSPHFDEVHKIIFRAAANVSKGTRQVKAG
TGPDVHRRQSKPPVSKL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcaccatcaggcaatctgaagttatatgcagatcttatgtcccagcccagtcgagct
gttctcctcttctgcagggttaacaatattgatgtggaccagcaactgattaatatccag
aaaggggaccataaaacgccagagttcaaagcaatcaatcccttgggaaaagttccgtgt
attgttgacggccgtttcaagcttgcggaaagtcatgctattatggagtatttggcagca
acacgtccaggcgtagctgaccactggtacccaactgacgttcaaaggagatcaaagatt
aattctgtgctggattggcaccatttaaatctgcgacgtggttccatgaccctggtgttc
cacaaagtattagcaccgatagtaggggtcaaagcagacccaagggcagcagcggaaggg
ctttccatacttcagcagtcattgcaagtcttagagacagtgtggttgcaagaaggttat
ccatttctagcaggcgggaggcagccatctattgctgatttgagtcttgtttgtgagatc
atgcagctgcaggtcttaggtgaggaggaagttgcggcgctgttgagctccaaggaacgt
gttactgcatggatagccgcggtaaaaaaagctacatctccacattttgatgaggttcac
aaaatcattttcagagctgcagcaaatgtgtcgaaaggaacacggcaagttaaagcaggt
accggacctgatgtccatagacgccagtcaaaacctccggtgtctaagttatga

DBGET integrated database retrieval system