KEGG   Physcomitrella patens subsp. patens: 112278011Help
Entry
112278011         CDS       T01041                                 

Definition
(RefSeq) stromal 70 kDa heat shock-related protein, chloroplastic-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp03040  Spliceosome
ppp04141  Protein processing in endoplasmic reticulum
ppp04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    112278011
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112278011
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112278011
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ppp01009]
    112278011
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ppp03041]
    112278011
   03009 Ribosome biogenesis [BR:ppp03009]
    112278011
   03110 Chaperones and folding catalysts [BR:ppp03110]
    112278011
   04131 Membrane trafficking [BR:ppp04131]
    112278011
   03051 Proteasome [BR:ppp03051]
    112278011
   03029 Mitochondrial biogenesis [BR:ppp03029]
    112278011
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppp04147]
    112278011
Protein phosphatases and associated proteins [BR:ppp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     112278011
Spliceosome [BR:ppp03041]
 Complex B
  Other components
   Prp19 complex
    112278011
 Complex C
   Prp19-CDC5 complex
    112278011
Ribosome biogenesis [BR:ppp03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    112278011
Chaperones and folding catalysts [BR:ppp03110]
 Heat shock proteins
  HSP70 / DNAK
   112278011
Membrane trafficking [BR:ppp04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    112278011
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    112278011
Proteasome [BR:ppp03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    112278011
Mitochondrial biogenesis [BR:ppp03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    112278011
Exosome [BR:ppp04147]
 Exosomal proteins
  Proteins found in most exosomes
   112278011
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FtsA FGGY_C BRX_N StbA DUF5398
Motif
Other DBs
NCBI-GeneID: 112278011
NCBI-ProteinID: XP_024366739
Position
26
AA seq 710 aa AA seqDB search
MATVMNAHAVSAAVGAVGATADAKCARRNGKYSMRRNAFFGGDVKSRAGFGEGLARLRAR
SQGQSRRAAAPLRVVAEKVVGIDLGTTNSAVAAMEGGKPTIVTNAEGARTTPSVVAYGKN
GDRLVGQIAKRQAVVNPSNTFFSVKRFIGRKMAEVDDEAKQVSYQVIRDSNGNVKLDCPA
IGKSFAAEEISAQVLRKLVDDASKFLNDKVTKAVVTVPAYFNDAQRTATKDAGRIAGVDV
LRIINEPTAASLAYGFDRKANETILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTHLGGD
DFDKRIVDWLADEFKKTEGVDLLKDKQALQRLTETAEKAKMELSSLSQASISLPFITATA
DGPKHIDTTLTRAKFEELCSDLLDRCKTPVENALRDAKLSYRDLDEVILVGGSTRIPAVQ
ELVKRITGKDPNVSVNPDEVVALGAAVQAGVLAGEVSDIVLLDVTPLSLGLETLGGVMTK
IIPRNTTLPTSKSEVFSTAADNQTSVDINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVP
QVEVRFDIDANGILSVSATEKGTGKKQDITITGASTLPKDEVERMVEEAERFGQADKEKR
EAVDTKNQADSVVYQTEKQLKELADKVPAEVKDKVEAKLKDLKDAIASDNTQSMKDAIAA
LNQEVMQFGQSLYNQPGGAPEGSAPGAQGSSTGPAAGGDDVIDADFTDSK
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgttatgaacgcacatgctgtgtccgctgctgtgggcgccgtcggagctact
gcagatgccaagtgcgcacggagaaatggaaagtatagcatgcgtaggaatgcgttcttc
ggtggagacgtgaagagcagggcgggatttggcgagggcttggcgagattgcgagccagg
tcccagggacagagtaggagagccgcagcgcctttgagagtcgtggcggagaaggtggtg
ggtattgatttaggtaccaccaattccgctgtagcggcgatggaaggaggtaagcctaca
attgttaccaacgccgagggcgctcgcaccaccccatctgtcgtggcatacggcaagaat
ggtgataggctcgtgggccagatagccaagcgccaggctgtcgttaatccttcgaatact
ttcttctcggtgaagagatttattggccgaaagatggcagaggtcgacgacgaggcgaag
caggtgtcttaccaagttattagggattcaaacggcaatgtgaagttggactgcccggct
atcggtaagtcgttcgctgcggaggagatctccgctcaggtgctgaggaaattagtggat
gatgcgtccaaatttttgaacgacaaggtcactaaagccgttgtcacggtcccagcctac
ttcaatgatgcacaaagaactgccacaaaagacgccggtcgaattgccggagtagatgtg
ttgcggatcattaatgagccaaccgcggcttctttagcttacggcttcgatagaaaagcc
aacgagaccatcttagtatttgatttgggaggtggaacatttgacgtctcagttttggaa
gtcggtgatggagtgttcgaagttctatcaacttctggggatacacatctcggaggcgat
gattttgacaagagaattgtcgactggctagctgatgaattcaagaagacagagggagtg
gaccttttgaaagacaaacaagccttgcaaaggttgactgagactgcagagaaggcgaag
atggagttgtcctctctttctcaagctagtattagcctgcctttcataaccgccacggcg
gatggaccgaagcacatcgataccacgttgaccagagccaaattcgaggagctgtgctct
gacctacttgacaggtgtaagactccagtagagaacgccttgagagatgctaagttgagc
tacagagatctggacgaggttattcttgttggaggttcgacaagaataccagcagtgcag
gagttggtcaagagaatcacgggaaaagaccccaacgtgtctgtgaaccctgatgaggtt
gtcgctcttggagccgcagtacaggctggtgttttggctggtgaagtcagcgacattgtt
cttctggatgtgacgcctctgtctttgggtttggagacgttgggtggtgtgatgacgaag
attatccctaggaatacaactttaccaacctccaagtcggaggtgttctcaacagctgcc
gataatcagacgagcgtggacattaatgttctgcaaggagagcgtgaatttgtgagagac
aataagtctcttggaagcttcaggttggatggcattccaccagctccccggggtgtacct
caagtggaagttcggttcgatattgatgccaatggtattttgtccgtgagtgccacggag
aagggaacagggaagaagcaagacattactattacgggagctagcacactgcccaaggat
gaggtcgagcgaatggtagaagaggccgagagattcggccaggctgataaggagaagaga
gaagctgttgacacgaagaaccaagccgactccgtggtataccaaactgagaagcagctc
aaagagctcgcggacaaggtcccagctgaggtgaaggacaaggtggaagcgaagctgaag
gacttgaaggatgccattgctagcgacaatacgcaaagtatgaaggacgcaatcgcagcc
ttgaaccaggaggtgatgcagtttggccaatctctgtacaaccagcccggaggtgccccc
gagggaagcgccccaggcgcccagggaagcagcactggccctgctgcaggaggagatgac
gtgattgatgcggacttcacagacagtaagtag

DBGET integrated database retrieval system